CAZyme Information: MGYG000002224_02050

Basic Information

• Species: Faecalibacterium sp900540455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900540455
• CAZyme ID: MGYG000002224_02050
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	MGYG000002224_24|CGC1	65556.98	6.1974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002224	2335657	MAG	United States	North America

• Gene Location: Start: 21321; End: 23078 Strand: -

Full Sequence      

MSIPLPEYPRPALRRDSFENLNGRWQYAITSTAQLPAQWDGEILVPYSPESRASGVNRTL
EPGQWLHYRRSFSPPAGQGGRVLLHFGAVDYRCTVWVNGQQAGEHQGGYWPFALDITDLL
CPAGDDQLWVAVQDPTDRSPGARGKQSLHPGGMFYPAQSGIWQTVWLERVPDNYICSLTV
EPDFDQRQVRVRVHTSQPGGAVNLWAAVRAGGVCIAEDWGSDEADQEGELVLDIPEEHFF
PWSPDHPFLYDLSVAVPGGDQVHSYFALRKWSCAPDRQGVLRFCLNGKPLLLNGLLDQGY
WPEGLYTPPSDAAIEQELQRVKELGFNLLRKHAKIEPQRWYYHCDRLGLVVWQDMVNGGA
PYKLWFVTYLTNALLPLLRRMPDGPSRCRLLGRGDAAARDEYRRELTDTVQALRCHPCIG
CWVPFNEGWGQFDAAAATAALRQLDPTRLVDEASGWYDQGGGDADSRHSYFYPLRVKPGR
RAVALSEYGGIAWPMPGHESPGKVYGYGKAASRTDLTQRYQKLQLKKVLPLLRCGLSALV
YTQLTDVEEEVNGLFTYDRAELKPEATAVRSVNAALAAEFARLTN

Enzyme Prediction     

No EC number prediction in MGYG000002224_02050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	15	473	1.2e-96	0.5026595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.87e-28	1	450	1	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	5.37e-22	68	351	69	352	beta-D-glucuronidase; Provisional
PRK10340	ebgA	6.53e-12	18	450	41	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.50e-11	68	351	124	410	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.16e-10	18	171	1	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL90007.1	0.0	4	580	5	586
QIA41822.1	0.0	4	580	5	586
ATO99791.1	0.0	4	580	5	586
AXB30001.1	0.0	4	583	3	587
CBL01777.1	0.0	4	583	3	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.97e-140	5	573	26	579	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	4.65e-22	9	454	12	454	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	1.16e-21	9	454	37	479	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6U7I_A	2.45e-21	20	427	14	412	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
7VQM_A	2.51e-21	66	363	96	376	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.12e-22	68	509	60	475	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.78e-18	8	512	43	538	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
A7MN76	7.74e-17	16	501	60	542	Beta-galactosidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=lacZ PE=3 SV=1
A0KQH4	1.34e-16	68	463	126	493	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1
T2KM09	2.16e-15	20	455	50	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002224_02050.