CAZyme Information: MGYG000002224_01203

Basic Information

• Species: Faecalibacterium sp900540455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900540455
• CAZyme ID: MGYG000002224_01203
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000002224_7|CGC1	23972.24	8.9784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002224	2335657	MAG	United States	North America

• Gene Location: Start: 43178; End: 43849 Strand: -

Full Sequence      

MKTVAQTVIEAERFYTIAAQTGYVIQAVEGVENGGDIRLGKYEHKPEQEWSFIRVGEGVY
RIRNRANGKLIDLMMTGTANGTWLHLWEDVGGTSQMWSVEPNPNGTVRVRSSWAGGKCID
TVGMGAEIGAILQIWQEANGADQLWTISEVKDRAKRAPAAEAKAEEPAAPAVEAKVEEPA
APAAEAKVEGPAAPAAEVKPAAAPAAKKPAAKSRRKCANRKKR

Enzyme Prediction     

No EC number prediction in MGYG000002224_01203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	13	156	1.8e-21	0.723404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14200	RicinB_lectin_2	1.17e-20	46	135	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	3.60e-08	93	152	1	59	Ricin-type beta-trefoil lectin domain-like.
NF035929	lectin_1	7.90e-08	27	147	727	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
cd00161	RICIN	8.34e-08	14	147	2	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
pfam00652	Ricin_B_lectin	6.55e-05	59	149	2	86	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO98528.1	1.69e-71	1	167	1	165
QIA43059.1	1.69e-71	1	167	1	165
ATL88890.1	9.68e-71	1	167	1	165
CBK97866.1	2.23e-67	1	166	30	195
AXA82809.1	2.23e-67	1	166	30	195

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002224_01203.