CAZyme Information: MGYG000002222_00331

Basic Information

• Species: Dialister sp900543455
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900543455
• CAZyme ID: MGYG000002222_00331
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000002222_7|CGC1	36427.54	6.7239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002222	2243264	MAG	Peru	South America

• Gene Location: Start: 19751; End: 20737 Strand: +

Full Sequence      

MKKQAIFALAAASSLLLFSGCGAAPLKSGSHPPVTETGWIVSWDKEKGWEMYDKTKERWG
SVSYFAVTFDEKGILKVPADLPKTKGTPFYLTFVNDVTKSNGHSNEKDTDILRHVLRDEH
ARRVHAKEILAIAEACGADGIDIDYERIGKDPKLVEAFTHFTQLLYLESIPAHKKIRIIL
EPSMPMDAPYSVGPEYVVMLYNLYGLHSGPGPKADGPFIEKTIRKMEALPSKKAVAFSNG
GCLWKDAGLFGLVKGTPRFITTEEAVRLRDAHQAKPERDEASAALHFSYQEDGHTYEVWY
ADEETLDAWTTLAANRGIPSVSLWRLGG

Enzyme Prediction     

No EC number prediction in MGYG000002222_00331.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.43e-28	62	327	29	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	2.19e-28	71	328	37	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
COG3858	YaaH	1.44e-15	61	327	130	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	5.19e-06	107	328	77	333	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.23e-05	108	328	75	306	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR71130.1	6.32e-105	16	328	14	331
BAL81914.1	1.31e-97	15	328	14	335
AEB99159.1	4.28e-84	16	328	14	330
QDR79732.1	1.41e-80	12	328	15	336
AIF51322.1	3.98e-80	12	328	15	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.95e-09	62	327	136	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DPJ9	1.90e-08	62	327	135	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	8.02e-08	62	327	135	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000134	0.071204	0.928498	0.000068	0.000067	0.000049

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002222_00331.