CAZyme Information: MGYG000002221_02187

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889
• CAZyme ID: MGYG000002221_02187
• CAZy Family: GH43
• CAZyme Description: Beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		22076.84	6.4928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002221	2286055	MAG	Peru	South America

• Gene Location: Start: 37; End: 606 Strand: +

Full Sequence      

MPHRFADVKSRPGWVRLRGQEARTSLNKTSILARKLTSVYAQITTKMDFTPEVHQHSAGL
ILYYDNMNYINLRKYYSETLGQSAISVIQLENGEKTEFVNTRIPVDDVPIYFRLVIEGRH
SQFYWSYDGENYEKIGIPFDTTKFSDEYCKYGEFTGTMVGITCADRVKHKHYADFDFFEY
IADESKNVE

Enzyme Prediction     

No EC number prediction in MGYG000002221_02187.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17851	GH43_C2	2.82e-59	1	180	20	202	Beta xylosidase C-terminal Concanavalin A-like domain. This domain is found to the C-terminus of the pfam04616 domain. This domain adopts a concanavalin A-like fold.
COG3507	XynB2	2.90e-29	8	180	372	546	Beta-xylosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98289.1	1.56e-110	1	189	359	547
AXB66701.1	1.83e-109	2	189	361	548
AVB51835.1	1.83e-109	2	189	361	548
AUA39010.1	1.83e-109	2	189	361	548
AYD12342.1	1.83e-109	2	189	361	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YRZ_A	2.94e-29	5	180	347	523	ChainA, xylan beta-1,4-xylosidase [Halalkalibacterium halodurans C-125],1YRZ_B Chain B, xylan beta-1,4-xylosidase [Halalkalibacterium halodurans C-125]
2EXI_A	9.14e-24	5	180	354	532	ChainA, beta-D-xylosidase [Geobacillus stearothermophilus],2EXI_B Chain B, beta-D-xylosidase [Geobacillus stearothermophilus],2EXI_C Chain C, beta-D-xylosidase [Geobacillus stearothermophilus],2EXI_D Chain D, beta-D-xylosidase [Geobacillus stearothermophilus]
2EXH_A	9.14e-24	5	180	354	532	Structureof the family43 beta-Xylosidase from geobacillus stearothermophilus [Geobacillus stearothermophilus],2EXH_B Structure of the family43 beta-Xylosidase from geobacillus stearothermophilus [Geobacillus stearothermophilus],2EXH_C Structure of the family43 beta-Xylosidase from geobacillus stearothermophilus [Geobacillus stearothermophilus],2EXH_D Structure of the family43 beta-Xylosidase from geobacillus stearothermophilus [Geobacillus stearothermophilus]
2EXJ_A	9.14e-24	5	180	354	532	ChainA, beta-D-xylosidase [Geobacillus stearothermophilus],2EXJ_B Chain B, beta-D-xylosidase [Geobacillus stearothermophilus],2EXJ_C Chain C, beta-D-xylosidase [Geobacillus stearothermophilus],2EXJ_D Chain D, beta-D-xylosidase [Geobacillus stearothermophilus]
2EXK_A	9.14e-24	5	180	354	532	ChainA, beta-D-xylosidase [Geobacillus stearothermophilus],2EXK_B Chain B, beta-D-xylosidase [Geobacillus stearothermophilus],2EXK_C Chain C, beta-D-xylosidase [Geobacillus stearothermophilus],2EXK_D Chain D, beta-D-xylosidase [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07129	5.35e-21	5	180	353	530	Beta-xylosidase OS=Bacillus pumilus OX=1408 GN=xynB PE=1 SV=2
P94489	6.36e-20	12	180	360	530	Beta-xylosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=xynB PE=1 SV=2
P77713	8.71e-20	5	180	355	533	Putative beta-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yagH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002221_02187.