CAZyme Information: MGYG000002221_00042

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1889
• CAZyme ID: MGYG000002221_00042
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002221_3|CGC1	42751.29	5.187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002221	2286055	MAG	Peru	South America

• Gene Location: Start: 1178; End: 2314 Strand: +

Full Sequence      

MSMAGRIAAAGLATVSAAFLIKSMSKNKFESAYDAVSNIKIGWNLGNTLDAHGKLKGWNK
PAKYETAWKNPITEKSMITVVKNAGFNAVRLPVTWYEHCDTDGDIDTDWLDRVQEVVDYV
ISQDMYCILDVHHDAGENGWLCASEECYSKYARRFEGLWKNIAKRFEPYSDKLLFEGFNE
MLDGSYSWDVPKDEKAYGILNDFNQLFVDTVRSTGGNNLRRNLVIEVYSAACTEPVLDAF
AMPDDTADGHIIVQVHNYDPQGFTFPKAPWITLTDKWGSDDDIKHLDELFARLEKYSDKF
GAPMIVGEFGAFDKNNTEDRTRYAYEFASRAAAVGIKCFWWDAGGMDILDRRNRRIKFPT
IAAALVRGAERKPLDIKA

Enzyme Prediction     

No EC number prediction in MGYG000002221_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	64	344	1.1e-92	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.63e-52	49	347	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.14e-26	42	342	54	358	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF24720.1	1.72e-105	13	369	24	387
AEX97596.1	2.32e-93	31	369	34	379
QRX63738.1	3.55e-91	28	370	144	480
BAE46390.1	6.78e-87	37	369	184	539
ADU21608.1	1.67e-85	30	369	31	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	4.42e-82	30	365	11	347	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	3.52e-81	30	365	11	347	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
3VDH_A	7.88e-80	30	364	11	346	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6D2W_A	1.01e-77	30	365	434	770	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6WQP_A	4.53e-76	31	367	15	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	1.18e-71	23	368	23	377	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P10477	2.09e-65	31	374	56	390	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28621	5.67e-62	31	369	41	374	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P20847	6.73e-59	31	376	38	402	Endoglucanase 1 OS=Butyrivibrio fibrisolvens OX=831 GN=end1 PE=3 SV=1
P17901	1.12e-58	36	369	51	400	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.981028	0.018812	0.000047	0.000064	0.000024	0.000034

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002221_00042.