CAZyme Information: MGYG000002219_01948

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_01948
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37544.19	8.1062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 731; End: 1753 Strand: -

Full Sequence      

MRPVERPSDLSFETVVDNPDGLGGLATLRRARITWKGPYGSQSIVATAFIPKTASPAAPA
PAFVFIAGRGGTINTRRLSTDGQVGAFDRDERWPAEEMVRRGYAMVAYDCTDVAEDDDSE
FKADVFRCFTRPEDRTGESWATISAWAWGASRVLDWVETVKSIDAAHVGVVGLSRRGKAA
LWAGATDTRFAMSCSAGSGCCGAKLFRHEERGAETIRRILRFRHWFCRNFDRYAGRDAQM
PFDHHQMLALVAPRLLCVASGSEDSGAGPQGEYRAAFEASPAWELYGKRGLVSNGFPKPG
EARQDGCVSYHLRKGGHDLVAEDWRRFADFAERHGWLKGK

Enzyme Prediction     

No EC number prediction in MGYG000002219_01948.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	80	334	5.6e-65	0.7955390334572491

CDD Domains     

MGYG000002219_01948 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF91189.1	3.76e-74	3	340	69	398
QHT60959.1	9.51e-74	6	338	49	370
QNK58798.1	9.95e-71	6	334	48	370
QHW35286.1	6.63e-70	4	334	47	366
AQQ72110.1	5.84e-68	5	334	102	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	9.38e-60	3	338	46	398	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	1.46e-59	3	338	64	416	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	2.14e-59	3	338	75	427	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	4.05e-59	3	338	64	416	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	1.12e-58	3	338	64	416	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	4.38e-52	92	334	185	426	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P0CT88	2.20e-19	102	295	146	347	4-O-methyl-glucuronoyl methylesterase 2 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.11.1537.1 PE=1 SV=1
P0CU53	2.21e-19	102	287	148	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
G0RV93	1.01e-18	136	287	238	396	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
A0A1D8EJG8	1.56e-18	136	300	268	438	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_01948.