CAZyme Information: MGYG000002219_00374

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_00374
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29014.82	9.0886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 4904; End: 5689 Strand: -

Full Sequence      

MHGENGGSIPWRLKAKQHSTGSSYPTHGLGPVALAMNVNRGDRFDYLVSLGSAGFGYQDY
ARRKYGADSFLARTPIEYNDVNTTLIRTVKGKSIMLQQYGSGPHPYSRMNKLVGTEGVAG
TYPLRVALEKTLGAEVKEWMDAKELKEFGKRHEHPLWRKAGDIARVSGGHGGMDFLMDLR
WVYCLQQGLPVDMDVYDLASWSSLVELTQTSVRSRGRTMDVPDFTRGGWSSAPAAGDMDI
DFDKVHLDVDKVRLTGRQQNV

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	10	230	2.2e-74	0.5388471177944862

CDD Domains     

MGYG000002219_00374 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG54101.1	3.84e-70	1	229	218	443
QGA23904.1	3.68e-68	11	230	237	453
BBL03363.1	5.45e-68	11	229	238	453
BBL15440.1	5.45e-68	11	229	238	453
QBJ62484.1	2.42e-67	1	236	206	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.20e-58	3	231	210	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.97e-35	11	232	212	434	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1S4U5	6.34e-65	11	236	229	452	Glycosyl hydrolase family 109 protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=Sama_1194 PE=3 SV=1
Q0HH61	6.49e-65	11	236	230	453	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_2535 PE=3 SV=1
A4Y8C8	3.86e-64	1	236	207	455	Glycosyl hydrolase family 109 protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=Sputcn32_2490 PE=3 SV=1
A0KYQ9	5.06e-64	11	236	230	453	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_2701 PE=3 SV=1
Q0HTG8	7.13e-64	11	236	230	453	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_2602 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_00374.