CAZyme Information: MGYG000002207_00823

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS2016
• CAZyme ID: MGYG000002207_00823
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		27832.08	9.6553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002207	1045475	MAG	Spain	Europe

• Gene Location: Start: 17; End: 742 Strand: +

Full Sequence      

MVATAGTIFVQNDKKNFVTKLQQWDYTLGIFGVKMYQGNYNATLVAQGAFSAYITKEVKE
IGGWQPCVGEDIVLTWTLLENGYKVNFAQDAIAFTQTPETWKDLFRQRKRWARGMIEALK
KGNVFTSKKLNWKSRFLMCLNLCFPFVDLALLLFIPLGILFLLFDNQLLMGWLTLLVILL
GLILCFVIELKRRNALKEVDCKLERRSILAFIFYALLYAFVLSPACLTGYIKELFSTRKE
W

Enzyme Prediction     

No EC number prediction in MGYG000002207_00823.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	174	1.1e-16	0.7461928934010152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	3.30e-23	2	170	170	334	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	5.28e-12	48	163	211	330	N-glycosyltransferase; Provisional
cd06421	CESA_CelA_like	5.58e-12	58	119	172	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	7.42e-12	2	71	110	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd04190	Chitin_synth_C	6.35e-11	3	118	106	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY63842.1	1.93e-56	3	241	194	429
APR04545.1	4.47e-56	3	241	232	467
QIC65547.1	5.64e-56	3	241	112	347
QIC68607.1	5.64e-56	3	241	112	347
AWD71445.1	5.78e-56	3	241	87	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	1.58e-09	14	150	198	338	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q99QX3	6.77e-09	3	138	159	294	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q8NUI7	6.77e-09	3	138	159	294	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q7A351	6.77e-09	3	138	159	294	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q9RQP9	6.77e-09	3	138	159	294	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
142	164
169	188
209	231