CAZyme Information: MGYG000002199_00698

Basic Information

• Species: UBA11940 sp900549005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11940; UBA11940 sp900549005
• CAZyme ID: MGYG000002199_00698
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000002199_17|CGC1	51948.9	5.5459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002199	1478990	MAG	Spain	Europe

• Gene Location: Start: 22749; End: 24140 Strand: -

Full Sequence      

MQKIKIAYIGGGSKMWARVFMSDLAVAEGLGGEMALYDIDIPAAERNAAIGGYINADPAA
KSRFEYRVYKDLDGALAGADFVVISILPGTFKEMRSDVHAPEKYGIYQSVGDTAGPGGVL
RAMRTVPLYEGFARKIAQICPNAWVINFTNPMSICVKTLYDVFPEIKAFGCCHEVFHAQE
FLCCALKEILGEEVHRSRIYTDACGVNHFTWITEARYKNIDLLALIPEFERRFYNEGYCE
QEGHGRFDFLTDPFCYGNKVKMDLFNKYGALAAAGDRHLAEFMPSGWYLKDPQTVKSWLF
NLTTVDYRERQQSERIAETIEMAEGRKKFPVVKSQEEAVELMKAIMGFKTVVSNVNMPNL
GQMPQMPLGSIVETNCVFSNGQVKPVTARPLPAAVCNMVYRACVNIDVCYEGIKERDLGK
IYLSFANQALCDGLSMEESRALFKEMCLNTRACLDEYFDLSVL

Enzyme Prediction     

No EC number prediction in MGYG000002199_00698.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	5	182	8.1e-53	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	2.90e-124	4	446	1	422	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	3.35e-77	1	395	1	379	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.33e-66	5	446	3	419	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.01e-49	5	188	1	183	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	1.89e-39	4	395	1	373	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ14011.1	6.75e-211	1	456	4	458
QTQ11811.1	5.51e-210	1	456	4	458
QTQ16221.1	9.05e-209	1	456	4	458
ADU22671.1	9.30e-205	1	459	1	461
APC39509.1	1.65e-157	1	455	8	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.37e-118	1	445	3	434	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	7.13e-25	2	399	3	381	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	4.50e-24	2	399	6	384	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	5.68e-14	1	298	1	279	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
6VC6_A	1.41e-09	2	254	2	245	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	1.41e-152	4	455	11	459	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	4.03e-149	1	451	8	447	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	1.67e-130	4	460	11	466	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	2.45e-122	1	446	7	439	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	1.59e-34	5	422	6	412	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002199_00698.