CAZyme Information: MGYG000002181_01131

Basic Information

• Species: Paramuribaculum sp000431155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp000431155
• CAZyme ID: MGYG000002181_01131
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		43581.35	7.8518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002181	2554789	MAG	Spain	Europe

• Gene Location: Start: 74321; End: 75529 Strand: -

Full Sequence      

MQKSHHIYTLTMTIRPFLALAALLAATALPAQITTAQYITPDTKETRSLVYNPGDEGSNQ
YRIPALVVTKDGALLAVADKRIDNINDLPGKIDVVARRSTDGGLTWGPHILIAEHDSIGG
YGDPAVVVDKKTGEIIVISTHGNGLWQTTPGHISVSRSKDNGLTWEKAVDINPQILTTDS
LGKQPIKCNSAFAISGRALQLKNGRIIFALITRQAGVECFPVYAIYSDDRGHTWHVSKNP
ATLDGDESKIVELADGTLLMSIRNRWGGGRYNGKRIFATSTDKGTTWSEPQPGKSLHAAA
CNGSIIRYTHGGKDLLLHSLPAPGKFREDITIYRSDDNGGTWTPTHLVSRAPGAYSSMAE
LPDGSIGILTEEAIGNCGERQSGGYRIWFTRISPEEFLTPIK

Enzyme Prediction     

No EC number prediction in MGYG000002181_01131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	51	375	9.8e-84	0.9327485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.40e-108	48	393	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.84e-26	90	368	14	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	2.58e-16	39	371	253	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13859	BNR_3	2.64e-11	63	336	1	263	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	7.81e-06	65	258	115	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR09640.1	6.71e-145	47	402	41	386
ANU63021.2	1.29e-144	47	402	60	405
ASB38906.1	1.29e-144	47	402	60	405
BBL05903.1	2.71e-82	29	393	11	373
BBD46557.1	4.21e-79	47	372	145	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	5.14e-44	50	376	170	509	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MYV_A	5.25e-43	50	376	170	509	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MNJ_A	7.25e-43	50	376	189	526	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MRV_A	7.64e-43	50	376	191	530	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
1EUR_A	1.49e-41	54	375	18	348	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.09e-40	19	375	23	390	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	2.87e-37	50	376	192	531	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	3.27e-29	50	371	384	809	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
O35657	8.87e-15	61	367	71	376	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
A5PF10	3.96e-14	61	367	78	382	Sialidase-1 OS=Sus scrofa OX=9823 GN=NEU1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.033992	0.964199	0.000757	0.000407	0.000327	0.000294

TMHMM  Annotations     

start	end
7	29