CAZyme Information: MGYG000002179_00286

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831
• CAZyme ID: MGYG000002179_00286
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002179_2|CGC1	42817.62	4.5882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002179	2310214	MAG	Spain	Europe

• Gene Location: Start: 64630; End: 65766 Strand: +

Full Sequence      

MKKHIVTIMALMALVTVGAGAQAPEAQEVKSMLRLVADWERANHLIDEGEHGDLAWTQAA
LYVGMLDWAEVAEKEDGDDSYYQWIRRIGRRNSWQTGKMMYHADDIAVSQAWLTMYEKYR
ERNMLLPTLARTEFVLRYPSCSTLDLDYSIAATLERWSWCDALFMAPPVYARMYVLTGRP
EFLEFMDREYKATYEYLYDKEARLFYRDWRYFDDREANGEKVFWGRGNGWVLGGLAELLQ
IFPETNAYRDFYEDLFVDLASRLAGLQSPDGYWHASLLDPASYPSPETSATGFIVYGLAY
GVNAGLLDAATFTPVILKGWKALTDAVEPDGKLGWVQPIGADPKKVTREMTEVYGVGAFL
AAGVQVYTMLGGAGDNGK

Enzyme Prediction     

No EC number prediction in MGYG000002179_00286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	367	7.6e-83	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.86e-95	36	370	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.76e-47	56	362	36	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70899.1	8.86e-183	28	369	27	367
ALJ58171.1	2.94e-181	28	370	27	368
QUT90811.1	2.94e-181	28	370	27	368
QDO67620.1	2.54e-178	3	370	5	371
QGT72377.1	3.89e-177	1	369	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	6.48e-77	29	369	29	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	4.18e-64	28	362	32	367	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.07e-50	112	362	100	350	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4XUV_A	7.56e-10	159	333	149	330	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	9.82e-78	28	366	33	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.35e-76	29	369	36	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.09e-73	56	362	92	404	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000346	0.998813	0.000197	0.000209	0.000205	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002179_00286.