CAZyme Information: MGYG000002178_00984

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000002178_00984
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119		124401.36	4.3636

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002178	2197502	MAG	Spain	Europe

• Gene Location: Start: 2877; End: 6236 Strand: -

Full Sequence      

MSLAAVALPLTAAAQTIHFENDDYKAIGVYDTWEKSPFRAQNGKAAQLEGNVAVIDNFLN
TEDELLGYAPNTTEKILGVQRSRFGSNTFGVRIDLKEPFSLTDTTRYVHVFINKPKEGRV
MLVGLGKRTERADQSPEAEQFWVLSTSVVGADSHWYDAVFPIRGAMPIKDDNGNITATIE
IHSLVVVPDCESPHELTSDFLAYVDEIEISDDPNPRFRRGDYVVNFDEDATTNRTDRKLS
SISLNGSSDGNQTIDVSVADPQTLYRPMLTKMFTAKAGETVTPTFGYTARWMNGYVYLDR
GHDGRYTAELEDGWRIPEGSDLMTYAYVQKEEGGGGYASDGSEVSNNEAGDRINPPAFTI
PADLANGFYRMRYKLDWGSVDPGGRVDESNHIAHNAGTIVDVLLNLHGDKVLVSDANRNG
AVLSANGEDLNRYETPFGQPFTIKMVPENGFTYDGIRVTYGYNLDGDEYVHSTPQYFTTE
YPAYLFGEDDTFTLPAEIMIGEVRIEGLFVEIKGDTPEPGDDYPSNYGDDDVITRTDRSL
NSITFTATQGGATSLVTSDNKHVYQNRTNKQVKVMPGDEVTIGVNYTGRAMHHYLYVDYD
QDGQFDTTLNEDGTPSPASELVSYTYYEGKNSQGQTISGAAGDVAVNAAPSFKIHEALRP
GKYRARFKTDWNNLDPAGQPGPENLLTDNGGYIIDFLLNVVSGNETVEVLTEHGSVNGAN
YTGLPLTAPVGTSLTVVPTPASDDFEFKGMTIKHGLNFDGPQYIHGNRQWNEYTVNSDAR
YTIPADSLDGNIVITALWEPTSESEWRSVFVEEFDGEDGSQPDEMYWSRCVRENATWNRW
LSDSKEVIYVQDGKLVARAIPNPDQTTDNVPMITGGIKTQGKFPFLYGKVEGRILTNPHK
GNFPAFWMMPNVAVEGWPNDGEIDIFEQIDTENKAYHTVHSNWTYNLGNRNNPKSSFNEN
VSMDRYHTYGLEWTPTLLTWYVDGKKVGSYAKSENDQDALSKGQWPFDHDFYIILNQSVG
NGSWAADADVTHTYETLFDWVRVYQKDNYTDGIGNVSADQLLDVTATEGVLHIYTGSAQK
VMVCDMAGHPIFDNIIEGYKDINVMKGVYLVNGKKILVP

Enzyme Prediction     

No EC number prediction in MGYG000002178_00984.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	812	1044	6.4e-51	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.32e-62	810	1044	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	5.85e-25	812	1044	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	2.51e-20	798	1048	41	269	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd08024	GH16_CCF	6.72e-19	809	1020	2	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02178	GH16_beta_agarase	7.41e-18	849	1045	61	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	1.74e-175	3	804	13	789
QFQ13169.1	8.40e-112	521	1046	23	542
AUI55248.1	4.66e-83	799	1117	41	333
QUB81446.1	3.25e-82	797	1117	39	333
QUB87116.1	1.19e-81	805	1117	47	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	4.10e-39	801	1045	24	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	6.19e-27	805	1046	2	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	7.93e-27	795	1046	5	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	4.97e-26	795	1046	5	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
2VY0_A	2.32e-24	805	1044	12	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.48e-33	804	1052	54	295	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
C1IE32	9.88e-17	851	1027	65	244	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	1.45e-09	850	1047	278	460	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	2.33e-08	785	1047	201	460	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2
Q5AJC0	2.62e-06	808	1006	76	248	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.175221	0.823643	0.000298	0.000321	0.000263	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002178_00984.