CAZyme Information: MGYG000002176_00966

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01
• CAZyme ID: MGYG000002176_00966
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36804	9.2408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002176	2675847	MAG	Denmark	Europe

• Gene Location: Start: 9848; End: 10810 Strand: +

Full Sequence      

MSKHFFCTLLCFFVGCTFIFAQPQRLSDKYINYIKKYYPLAQQQQKMHGIPASITLAQGL
LESQCGESRLAKVGNNHFGIKCNGWTGDTILKDDDKINDCFRRYARAEDSFSDHSAFLKR
KRYAPLFNLKKDDYAAWARTLKKCGYATDPAYPDKLIRLIETYQLYKYDKNETPLFADNS
KSKNKVDTKYTDENITINDEQLATEIGNAHVIRRRWGLYYIVAHEGDTFASLAKELNVKE
KNLAKFNDLHKDDAIAPGETIWIEQKEKEAAMGNNQYTAKQGDTLHSISQYYGIRLKNLA
KMNKLKENSIITPGTVIILR

Enzyme Prediction     

No EC number prediction in MGYG000002176_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	165	1e-34	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	3.99e-40	33	169	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	2.05e-37	32	180	45	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	2.32e-25	39	165	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	4.90e-23	32	169	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	2.21e-18	52	314	172	444	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71591.1	4.16e-87	16	320	15	305
AHF12398.1	1.38e-86	24	320	22	299
QUT99590.1	7.16e-86	1	320	1	307
BBK88660.1	1.01e-85	1	320	1	307
QUT68216.1	1.01e-85	1	320	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	5.70e-12	50	174	80	217	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.17e-10	38	160	9	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.91e-10	38	160	10	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.15e-09	38	160	10	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	1.25e-06	49	161	22	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	7.15e-16	45	169	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	1.57e-13	17	318	170	472	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	5.02e-11	50	174	340	477	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9X9J3	7.72e-11	28	159	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	9.66e-10	28	167	159	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003784	0.686826	0.308564	0.000310	0.000250	0.000254

TMHMM  Annotations     

start	end
5	22