CAZyme Information: MGYG000002168_02245

Basic Information

• Species: Prevotella sp900556825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900556825
• CAZyme ID: MGYG000002168_02245
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		30625.24	8.0526

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002168	3553249	MAG	Denmark	Europe

• Gene Location: Start: 33; End: 848 Strand: +

Full Sequence      

MADGILSDSIRKPCYNPVLYQMPNGEILLFFKIGLYVADWSGWMIRSHDQGRTWSEKEPL
PTGYLGPIKDKPVLVGHRLICPSSTEVGGWKIHFEIYDLKKKTWKYVGPIEAEEAVPTVE
MKKEDPKKLPIECIQPTILKLKDGRLQVLCRTKNGKIATSYSSDQGDSWSKVTLMDLPNN
NSGLDAVTLKDGSFALIYNHATTEPGKEMGPRTPLNLAVSKDGSHWTDVLTLESKPGEYS
YPSIIQGKDGHLHCIYTWHRTHIRYQEVILK

Enzyme Prediction     

No EC number prediction in MGYG000002168_02245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	15	257	1e-29	0.716374269005848

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.83e-80	2	254	39	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.83e-39	8	265	70	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	2.69e-22	16	265	89	368	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	0.007	136	263	17	191	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK84931.1	7.75e-111	11	271	922	1198
QQY43427.1	3.53e-110	11	271	1045	1321
AII62782.1	4.90e-110	4	271	1038	1321
AND21950.1	6.58e-110	4	271	1035	1318
QUT83571.1	6.58e-110	4	271	1035	1318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999978	0.000036	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002168_02245.