CAZyme Information: MGYG000002166_00622

Basic Information

• Species: CAG-433 sp000433675
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-433; CAG-433 sp000433675
• CAZyme ID: MGYG000002166_00622
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
943		102939.51	9.1481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002166	1368396	MAG	Denmark	Europe

• Gene Location: Start: 11078; End: 13909 Strand: +

Full Sequence      

MMKKTNKKTSTKKTKSNDTVVKQKKKKKIKKILKLLLNIFLLLLLIGLIGGIVFAVYIVV
KAPNFDPKNLYSTEASIVYDKNGKQITKLGVEKRKNVNYDDLPQVLVDAIIATEDSRFMQ
HNGFDLPRFLKASAGQVVNKITGHGNAGGGSTLTMQVSKNNYTSVESSGFEGIVRKFTDI
YISIFKLEKNYSKEEIIEFYVNIPYLGNNSYGVEQACQSYFGKSVSDINLSEASLIAGLF
QAPASYDPYRHPDYAEERRNTVLYLMQRHGYITKEEAEDAKKISVTSLLRSSNPESESNE
YQSYIDVVIDEVEEKTGNNPYTTGMKIYTNLDTDKQTVLNDLMSGKTWTWKDDKVQAGVA
IVDVNTGALVAVGGGRNRTGARQLNYATDITRQIGSCAKPLFDYGPAFEYNNAGLASQVY
DGPHSYSSGVAIRNVDGSYGGTMTYKYALAASRNIPALKVFQSVDNSKIKEFVTKLGITP
EIDSNGGLHEAHALGAFTGSNPKSMAAAYAAFANGGYYAEPYTINKVEYIDSDKTVSLKS
KRTRVMSDSTAYMITDALTYAVSSYGNIGGSVSGVQLAAKTGTTMFDETARKKYGYPSSA
NMDMWVTGYTPEYAVSLWYGYTEAEKGYYLGSEGYSVRGKIFRQIISGISDKSGSKKFTV
PSSVVKVTVEKETSPLMLPSANTPDNMKVTEYFKKGTQPTEVSPRYSALPNASGLTAKTN
GNQVELTWTAAEKPEYLTDDYFRKNYKNYFGSSLETALSSRKASDGEFGYEVLVKDNNTG
TTNSLGFTTETSFKTTKINSNVTYIVKTKLANLSCTASSGITTNVKGEPEKTSSLLTYEL
NGNLKDTATVGNSYTDAGIKVFSDGIDVTSKAKITVSCAELGTSGKAQKETYTFTKAGTY
TLKYTISYNGSTETATRTITVSDSSSGTGGNSGNETDQTTNTN

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	83	267	7.3e-54	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	5.15e-145	53	714	33	661	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.96e-98	53	726	22	796	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.75e-68	82	267	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	2.97e-67	92	620	145	656	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.52e-55	54	730	13	635	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG61477.1	3.42e-160	50	728	53	715
AKO91601.1	1.98e-157	51	728	53	742
AXM90108.1	3.80e-156	51	703	46	687
AKS38635.1	2.93e-155	51	703	46	687
ACJ33515.1	2.93e-155	51	703	46	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	2.27e-99	78	664	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.96e-96	61	664	2	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	1.65e-65	186	630	2	441	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.13e-62	186	630	2	441	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	5.58e-48	303	666	11	379	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	8.32e-141	50	727	52	724	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	3.80e-105	50	651	28	628	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	4.73e-101	50	666	29	642	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	6.58e-101	50	666	29	642	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	2.62e-71	52	676	30	622	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999902	0.000121	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
35	57