CAZyme Information: MGYG000002165_00429

Basic Information

• Species: Zag1 sp900551675
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900551675
• CAZyme ID: MGYG000002165_00429
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000002165_5|CGC1	30691.61	7.6245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002165	1948134	MAG	Denmark	Europe

• Gene Location: Start: 16588; End: 17406 Strand: +

Full Sequence      

MTTILKEISISGNGLMKNKPCTVNFFPSKTGKIRYFIKGAEPFEACVENVLSTDHCVVLG
NSKTKAMLTEHLTSALAFCGIDSVDICMDEMEVPALDGSSKKWVELFEKAGIEKHIFQKP
KHYTVSEPVYYLNGKTSLIILPSDELYISYAVNYDHPDLTRRWCAYNPKNKQEIIEARTF
GFYRDLKKFQMLGFAQGVTIENTLGLQDNGYTSELRSENEPIKHKILDLIGDLYLTGINP
LNLKCQILAKEAGHAVHIKTAKMLKDKLIECK

Enzyme Prediction     

No EC number prediction in MGYG000002165_00429.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	2	264	2e-67	0.985239852398524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	1.38e-72	2	266	2	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	6.15e-68	2	264	5	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.07e-65	2	267	5	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	6.25e-50	3	265	7	299	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	7.77e-48	2	267	4	274	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38878.1	2.61e-168	1	272	36	310
AGB42301.1	8.56e-46	3	269	7	275
BBH38876.1	8.27e-45	1	265	2	269
BAG03744.1	8.27e-45	1	265	2	269
BCU10606.1	2.32e-44	1	265	2	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GO3_A	2.56e-30	3	267	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO3_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO4_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2GO4_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
1P42_A	2.73e-30	3	267	5	265	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1P42_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
2IER_A	2.79e-30	3	267	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IER_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2J65_A Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2J65_B Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2O3Z_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2O3Z_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],3P76_A X-ray crystal structure of Aquifex aeolicus LpxC complexed SCH1379777 [Aquifex aeolicus],4U3B_A LpxC from A.Aaeolicus in complex with the MMP inhibitor 4-[[4-(4-chlorophenoxy)phenyl]sulfanylmethyl]tetrahydropyran-4-carbohydroxamic acid - compound 2 [Aquifex aeolicus VF5],4U3D_A LpxC from A.Aaeolicus in complex with 4-[[4-[2-[4-(morpholinomethyl)phenyl]ethynyl]phenoxy]methyl]tetrahydropyran-4-carbohydroxamic acid (compound 9) [Aquifex aeolicus VF5]
3P3C_A	2.98e-30	3	267	5	265	CrystalStructure of the Aquifex aeolicus LpxC/LPC-009 complex [Aquifex aeolicus]
2JT2_A	2.98e-30	3	267	6	266	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],5DRO_A Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRO_B Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRP_A Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5],5DRP_B Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q051J2	4.46e-43	3	264	9	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) OX=355276 GN=lpxC PE=3 SV=1
Q04T70	4.46e-43	3	264	9	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) OX=355277 GN=lpxC PE=3 SV=1
Q72RV5	3.46e-42	3	264	9	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=lpxC PE=3 SV=2
Q8F3U4	3.46e-42	3	264	9	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) OX=189518 GN=lpxC PE=3 SV=1
B0S9V0	1.07e-40	3	268	9	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) OX=355278 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002165_00429.