CAZyme Information: MGYG000002152_01580

Basic Information

• Species: UBA5446 sp900544295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900544295
• CAZyme ID: MGYG000002152_01580
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		29286.33	4.6239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002152	2803193	MAG	Germany	Europe

• Gene Location: Start: 813; End: 1625 Strand: -

Full Sequence      

MKRVFCLFFALLFVCPAAAEEEGTRLPVIMYHHISADPARAGDYVVTPELLEGDLRWLSE
RGYTAVGLKDILNYRAGLGGLPEKPVLITFDDGQQSVLEYALPLLEKYDMRAVAAVVGAY
CDAEEGAAARSPEYSYLSWAEVAELAASGRFDIACHTQDMHRESSPRRGCLPKPGEGGEA
YAAALSADLAAVEAKIEAASGARPLAFAYPFGFHCDETEALLRARGYLLALTCENRVDDV
APGEGLLTLGRFNRSANLGREEFFALLGIK

Enzyme Prediction     

No EC number prediction in MGYG000002152_01580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	80	229	3.4e-24	0.9153846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	7.65e-34	85	257	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	5.87e-31	48	253	1	201	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	1.97e-30	82	263	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
PRK14582	pgaB	2.76e-29	28	240	51	281	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB.
PRK14581	hmsF	4.98e-27	28	263	51	301	outer membrane N-deacetylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS79569.1	1.25e-35	26	253	31	257
ASF40455.1	2.92e-32	19	253	203	438
CCG46444.1	2.92e-32	19	253	203	438
QIY79676.1	9.25e-32	11	267	8	275
AAQ61937.1	1.27e-31	11	267	8	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BU6_A	3.55e-21	21	234	8	245	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
4WCJ_A	1.43e-19	16	244	27	239	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	1.04e-15	25	212	3	211	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
3VUS_A	6.68e-13	29	161	11	148	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	1.90e-12	29	161	15	152	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31666	8.93e-14	17	251	161	387	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
P75906	1.07e-11	29	161	52	189	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	1.07e-11	29	161	52	189	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
Q6GDD6	9.73e-11	43	236	74	255	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q99QX2	2.43e-10	43	236	74	255	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.998960	0.000268	0.000162	0.000152	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002152_01580.