CAZyme Information: MGYG000002150_01651

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000002150_01651
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42018.33	4.5533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002150	1960881	MAG	Germany	Europe

• Gene Location: Start: 69; End: 1172 Strand: +

Full Sequence      

MGTFIKGMDVSSLRELEELGAKYYKDGREKDLLEILKEYGVNSIRLRLWNDPYSEAGVPY
GAGTNDLKTTIELARRVLDMGFGFLLDLHYSDFWADPGKQRIPKAWRGMDAAGLEQAVYD
FTRKTLETMQENQVFPTMIQVGNELSSGLLWPYGKYPDYDNMARFLNAGIRAVRSVDPSL
SVMLHLDNGGNNALYREWFDEFMKRGEDFEIIGLSYYPFWHGTLQQLEDNMHDIAERYGK
ELVVAEVSMGHTMEDYKEYEKLADTERKGMATKPELAAKIEYPMTESGQSDFMQDFMTRI
SRVKGSRGFYYWEPGWLPVPGSGWANAEALAYIEEQGPGGNEWANQALFDYNGNALQALE
TIRKFQP

Enzyme Prediction     

No EC number prediction in MGYG000002150_01651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	5	361	8.2e-135	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	5.29e-145	3	359	38	388	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	4.44e-141	5	359	1	330	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97298.1	8.56e-190	4	367	3	368
CBK83542.1	1.70e-187	1	367	36	402
VCV21326.1	8.07e-183	4	366	5	387
CBL10573.1	1.07e-182	4	366	3	385
CBL13099.1	8.72e-182	4	366	3	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	6.76e-92	4	363	50	392	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	2.72e-83	4	363	24	389	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	2.15e-82	4	363	24	389	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJQ_A	3.02e-53	6	364	5	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
4BF7_A	9.99e-53	6	323	22	324	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	2.45e-87	4	363	6	347	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	3.05e-82	4	363	49	414	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	1.56e-80	4	363	53	418	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q0CTQ7	1.44e-55	6	323	19	323	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
Q9Y7F8	2.25e-54	6	330	21	331	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002150_01651.