CAZyme Information: MGYG000002145_01377

Basic Information

• Species: Lachnoclostridium_B phocaeensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B phocaeensis
• CAZyme ID: MGYG000002145_01377
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266	MGYG000002145_15|CGC1	29833.73	3.8215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002145	2539580	MAG	United States	North America

• Gene Location: Start: 23529; End: 24329 Strand: +

Full Sequence      

MKKVWTSRLLILSAAFLLTACADGWQQEEDTGAEGSLPGELAQIPSDYFDETTYLGTSEN
PSAFKNVLDNAMAGGDMEPMIVVCPTYNNTSSSDSDNYGLALELTDNYHYELINDLIPAV
EGTYSTYADDTSPEGLAASRDHRAFCGFSMGLVTTWHTFEYCLDYFRYFMPSSGSLTTDG
DYMASIVRESGHDWDDFFIFAASGTEDFAYSSFRRQIQAMEDVEDVFRTADNEAEGNLWF
LVQEGGTHSGEYALQYFYNGMCWIWK

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	62	256	4.8e-19	0.7709251101321586

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	7.44e-06	67	194	118	232	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADA67819.1	5.96e-64	50	221	107	278
AGA59285.1	2.04e-49	56	259	398	598
AEY68182.1	4.86e-47	51	259	470	679
AGA59284.1	1.83e-46	56	259	385	589
AEV68181.1	1.01e-45	50	259	1279	1493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GKL_A	9.46e-43	60	261	88	283	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6FJ4_A	6.15e-40	60	261	74	269	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1GKK_A	8.63e-40	60	261	88	283	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1GKK_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],3ZI7_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],3ZI7_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],4BAG_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4BAG_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4H35_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],4H35_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],5FXM_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_AAA Chain AAA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_BBB Chain BBB, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1JJF_A	3.45e-09	67	178	88	182	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	8.53e-09	67	178	88	182	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51584	2.59e-38	60	261	876	1071	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10478	4.15e-08	67	178	107	201	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000048	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002145_01377.