CAZyme Information: MGYG000002140_02633

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_02633
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000002140_23|CGC1	36053.92	4.67

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 5445; End: 6389 Strand: +

Full Sequence      

MMPVNLHATENAKKLLKYLSEIGGQRIITGQHTKTVAMEEIAEIKRLTGKTPALRGFELL
AYSPNIRYETADEECLKEVAENKNTLEEALAFGKTGGIVTFTWHWFSPLGGRDKSFYAEN
TDFDATMVLQEGTAEREAFFHDLDRIAELLKPFLAEDIPILWRPFHEAEGNWFWWGVKGP
AVAAQLYRLHFDYFVNKYHLDNLLWVWNSPLPEGYPGDDVVDVISRDVYMPAGTATDYRK
EYEELSAITTAKKPVALAEIGILPDMDLLQESRVPWCYYMTWCGEFVLTEKYNSHETLKR
IYSSDYAVTFEAFS

Enzyme Prediction     

No EC number prediction in MGYG000002140_02633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	310	6.3e-97	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.89e-53	4	309	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	9.58e-17	144	261	169	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	6.43e-141	5	309	6	311
QNM01251.1	8.92e-139	1	309	6	333
AEB13973.1	1.53e-131	5	309	6	309
AZK45707.1	9.08e-131	3	311	6	315
QUL56288.1	1.35e-128	3	311	9	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.47e-72	3	309	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	5.05e-70	5	311	147	445	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	8.42e-54	3	311	34	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.29e-42	8	282	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	9.31e-41	1	309	21	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	3.28e-69	5	311	176	474	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.03e-58	3	311	28	348	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	4.42e-51	8	300	151	454	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.93e-49	4	303	29	323	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	1.92e-41	4	303	157	449	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002140_02633.