CAZyme Information: MGYG000002134_00398

Basic Information

• Species: Mailhella sp900541395
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900541395
• CAZyme ID: MGYG000002134_00398
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000002134_4|CGC1	32511.13	6.6917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002134	2752742	MAG	United States	North America

• Gene Location: Start: 30191; End: 31102 Strand: -

Full Sequence      

MLQTTIARTVSYTGVGLHSGKDVQMRLQPAPADSGIVFYVHTPSGVRHIAPRPSAVSATA
LATTLSDGQASVSTVEHVLAALAGMAVDNVQVHVFGGEIPIMDGSAVQAAALLKEAGLRS
LHAPRRVARVRRPLSVAGDGKAIHVWPHNGFYVDYTIDFPHASIGKQRLSLEITPDTFAE
IAFARTFGFLQEVEYLHSRGLALGGSLGNAVVLDEQGVVNPEGLRRPDEFVRHKMLDFVG
DMAMLGMPLQGAFEVHCSGHQLNNAFLRRLSEERGAYLEIVSLTRESAPAYEGEAFPAMV
VPA

Enzyme Prediction     

No EC number prediction in MGYG000002134_00398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	3	271	4.5e-99	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	3.52e-141	1	290	2	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
pfam03331	LpxC	1.29e-136	3	270	1	269	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
COG0774	LpxC	9.19e-114	1	292	2	296	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	5.00e-92	1	300	1	297	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	3.60e-72	1	273	3	301	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS97389.1	2.53e-117	1	290	1	291
ABM27472.1	2.53e-117	1	290	1	291
ADP87837.1	2.53e-117	1	290	1	291
ABB39780.1	1.42e-113	1	298	1	299
ADU62370.1	8.72e-113	1	283	1	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MO5_A	7.22e-71	3	289	9	298	Co-Crystalstructure of P. aeruginosa LpxC-50228 complex [Pseudomonas aeruginosa PAO1],6MOD_A Co-Crystal structure of P. aeruginosa LpxC-50432 complex [Pseudomonas aeruginosa]
5U39_A	7.78e-71	3	289	6	295	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	8.27e-71	3	289	4	293	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
2VES_A	8.78e-71	3	289	4	293	CrystalStructure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]
5U3B_A	8.78e-71	3	289	4	293	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q727D8	5.05e-118	1	290	1	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=lpxC PE=3 SV=1
Q30X16	2.84e-114	1	298	1	299	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20) OX=207559 GN=lpxC PE=3 SV=1
Q1MQP6	4.53e-93	1	286	1	284	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Lawsonia intracellularis (strain PHE/MN1-00) OX=363253 GN=lpxC PE=3 SV=1
Q3SMG6	2.33e-77	3	286	4	289	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=lpxC PE=3 SV=1
A7H914	3.75e-76	3	287	6	288	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000049	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002134_00398.