CAZyme Information: MGYG000002132_01275

Basic Information

• Species: Monoglobus sp900542675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus sp900542675
• CAZyme ID: MGYG000002132_01275
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000002132_50|CGC1	53699.61	4.8812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002132	1988610	MAG	United States	North America

• Gene Location: Start: 6551; End: 8029 Strand: +

Full Sequence      

MNTLSAVFDVTNYGVVGDGETNNTKKIAEVIAKMKEIGGGTIYFPPGQYVTGSIILGDNM
TLYLDGGATILGSADPEDYPLITNKEIEGYNRGGHTGLVAALNAKNITVTGRGTLDGRGY
NWWHTPKNEHRPRAFQPIMCENVRLDGISIINSAMWTVHPMCCRNITIDGISIKNPADSP
NTDGINPESCQNVHISNCQVDVGDDCVTLKSGTEDDLFQKQFPCENITITNCTMNNGHGG
VVIGSEMSGGVRNVTISNCVFNGTDRGIRIKTRRKRGGSVEDIRIDNIMMTNVFSPLTIN
GYYQCGGTDPNDMELFDLEKRPIEDSTPVFKNIYISNVTAREVKCAAGYIYGIPEMPVTS
LHVDNFVCSMTKGEHDVEYSPIMAWHVPPTKGCGFYCANMKDVSFNNVHLDVERTPSIII
ERSELVKVSGLTSEGSNTAVKLAESKDIMISNSMVSPTAKEFIVTDKKSEETLNVNGVAK
SNDSQEIVKTED

Enzyme Prediction     

No EC number prediction in MGYG000002132_01275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	34	400	1.3e-93	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.33e-91	5	358	80	466	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02793	PLN02793	2.29e-34	7	303	52	340	Probable polygalacturonase
pfam00295	Glyco_hydro_28	7.57e-34	104	308	50	255	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	9.74e-34	5	348	34	361	polygalacturonase/glycoside hydrolase family protein
PLN03003	PLN03003	2.44e-31	3	332	19	326	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19044.1	1.10e-303	1	492	1	492
APC39525.1	5.70e-120	1	442	1	445
QNF26697.1	1.25e-119	5	451	7	451
QFK71226.1	9.05e-117	8	434	9	433
AMO85307.1	2.03e-114	1	426	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	6.33e-41	9	340	29	383	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.94e-36	8	288	45	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	1.96e-18	49	304	52	315	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	2.39e-18	7	341	156	535	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MXN_A	1.03e-11	8	154	22	170	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.80e-48	10	365	65	421	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.00e-41	133	391	23	282	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q949Z1	1.47e-24	7	381	79	453	Polygalacturonase At1g48100 OS=Arabidopsis thaliana OX=3702 GN=At1g48100 PE=2 SV=1
Q9LW07	5.28e-21	3	332	19	326	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q7M1E7	7.57e-20	5	445	56	469	Polygalacturonase OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002132_01275.