CAZyme Information: MGYG000002124_00194

Basic Information

• Species: CAG-110 sp900763965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900763965
• CAZyme ID: MGYG000002124_00194
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000002124_5|CGC1	29867.29	4.8525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002124	2646709	MAG	Mongolia	Asia

• Gene Location: Start: 2226; End: 3005 Strand: -

Full Sequence      

MIPKKIHYCWFGKNPKTRLAEKCIKSWETLCPDYEIIEWNEDNYDLSAAPLYVRQAYEAK
KWAFVTDYVRLQVVYEQGGIYMDVDVELEKPLDLLLTHSAYFGYEDGVFINTGEGFGAEP
GTPILRELMEDYAEIPFLLEDGSLDLTSCPKRNTKIFLQHGLKQDDSMQILPGDVLILPT
IYLCPIDYVMMLRTRSPKTISTHWYDASWRPDRTWAKVETSVGLVVYYVKLGVKKVIGED
AYAVLKKIRGREEHTDAEG

Enzyme Prediction     

No EC number prediction in MGYG000002124_00194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	97	1.6e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	6.89e-18	1	133	81	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.25e-15	22	102	6	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.57e-06	1	134	45	193	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	1.44e-76	1	230	1	228
QPL58449.1	9.42e-70	1	248	1	246
VFA47977.1	9.42e-70	1	248	1	246
AVL44985.1	8.42e-68	1	247	1	245
QAA19310.1	1.19e-67	1	247	1	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	3.32e-07	2	173	64	242	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	8.87e-07	2	137	57	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002124_00194.