CAZyme Information: MGYG000002123_01073

Basic Information

• Species: UMGS1696 sp900763885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696; UMGS1696 sp900763885
• CAZyme ID: MGYG000002123_01073
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		46689.12	5.865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002123	2956735	MAG	Mongolia	Asia

• Gene Location: Start: 3941; End: 5182 Strand: -

Full Sequence      

MKTIRMGVIGLGGRGSWWLGELLKMEDVRVNAVCDIHEDRMEKGREMCREKYGCPVYGSV
RSHDIVIRDDLDAVLITTYWNDHVKIAIDAMRHGKYAAFEVGPAQSIQQCWDLVHTYEET
GVPCMLMENCCYNREEMTVLNMIKKGLFGEVLHCQGGYQHDLRAVAGGMATDHERTWHHL
HRNAEVYPTHELGPIMTYLDINHGNRLLALNSMATKSRGLAKYVKDHFPEDHPLQGVPFR
LGDIVTTTIRCANGETIVLTHDTSNPRPYSRGGRVQGTCGIWMEDLHALCIEGRTEGENW
DPMDKYWDEFEHPLWKKTHAAEFTGGHGGMDWLVMRAFLEAVRKGIQTPIDVYDSATLMA
ISILSEDSIATGSASVAIPDFTNGMWLKREPGPRSIFNLFNLDDSVYEGAVEF

Enzyme Prediction     

No EC number prediction in MGYG000002123_01073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	388	5.7e-149	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.01e-22	1	372	1	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.93e-09	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95391.1	2.88e-153	2	408	7	410
QTH41090.1	2.69e-149	1	398	7	405
ANY74959.1	2.36e-148	2	390	10	399
AEF80535.1	2.59e-140	2	407	7	418
ALS29040.1	2.28e-137	3	391	4	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.08e-104	2	386	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	5.81e-75	1	391	40	443	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	3.64e-09	1	172	3	176	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
6Z3B_B	2.07e-07	1	181	1	178	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]
6Z3B_A	2.10e-07	1	181	3	180	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	1.01e-112	2	391	32	446	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	5.27e-110	4	391	50	462	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	7.15e-108	4	391	53	464	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4Q8F7	2.23e-103	2	386	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
Q01S58	2.14e-96	3	391	42	437	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002123_01073.