CAZyme Information: MGYG000002120_01451

Basic Information

• Species: Porphyromonas pasteri
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas pasteri
• CAZyme ID: MGYG000002120_01451
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		58080.32	8.0646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002120	1877343	MAG	Mongolia	Asia

• Gene Location: Start: 103; End: 1704 Strand: -

Full Sequence      

MKTFLLASACLLLASGASLPAVASSTVALASVSPDSSARYQEHGTNASLIGRGFDQALFT
FTLPVAVGSTLESVTIDLSGTSRIKDVRQLKLYRTKNKDRFDHRTPGQLVASAPVKRASR
VKLDLSPRTTISSDDAFWVVCDIAPSAQEGGEVVSRLSALKTSSYELSTLPDAKEHRHGI
VLQRSLVWAPGEGGSLHYRIPGVVRLSDGTLVASIDRRKKNVNDLPGDIDVEIKRSIDDG
KTWSAPITVARGTSEHGYGDAAMATDGRTIYMVMVGGAGLWHYPSHATHPIQMYFTKSTD
GGRTWEPVTNITKSIYRDRFEYGGFFASGNGIMTSTGRIIFVAAIRTEEAWGGRADNVLA
YSDDQGKTWQISETARVNGDESKIVELSDGSLLVSCRNRAGGLNARTYVHSSDGGKTWSE
PKQWSELMGNACNGGFARYAPVGSKKNENLLLHTLPASATRDHLKIFLSEDEGKTWPYSR
EICRGESVYSELVIFPDGTIGIISEEDDNPGFDIYFTRVSLDWIRKGNAPRKK

Enzyme Prediction     

No EC number prediction in MGYG000002120_01451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	189	517	4.1e-73	0.956140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.71e-91	185	520	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.99e-22	227	502	14	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.07e-10	161	513	233	651	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam14873	BNR_assoc_N	8.66e-05	49	163	14	146	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
pfam15902	Sortilin-Vps10	0.002	298	454	6	135	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB42424.1	7.24e-218	38	532	267	764
QCX54140.1	1.13e-105	71	533	67	530
QUT75110.1	4.10e-98	46	527	272	760
BBD46557.1	1.63e-95	46	524	4	488
ACM91104.1	1.86e-93	71	527	221	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	1.41e-42	55	505	19	504	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	2.07e-42	55	505	40	525	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4Q6K_A	1.48e-39	55	505	22	507	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
1EUR_A	7.29e-37	191	530	18	365	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
4FJ6_A	2.65e-36	55	505	20	504	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	8.68e-35	55	505	41	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	1.52e-34	191	530	60	407	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P29767	4.63e-18	187	525	384	827	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P10481	8.27e-16	195	509	33	366	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	1.30e-15	197	509	53	384	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001358	0.997231	0.000560	0.000349	0.000249	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002120_01451.