CAZyme Information: MGYG000002119_01411

Basic Information

• Species: Neisseria elongata
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria elongata
• CAZyme ID: MGYG000002119_01411
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
682		76748.09	8.6742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002119	1636053	MAG	Mongolia	Asia

• Gene Location: Start: 184; End: 2232 Strand: +

Full Sequence      

MKTALIFSRGIRNTPHLSAFLPDYDLKKTTPPQTVIGWGYKPTADKARAFAAAHNLPYTA
LEDGFLRSLGLGVEGYPPLSLIIDDIGIYYHTAQPSRLEQLIMQADRLPAELSAQAETAM
RLIVGNRLSKYNHAADFAETDASKRPSEKPIVLLIDQTAGDMAVKYGGADEHTFQTMFQT
ALQENPQAEIWIKTHPDVLSGKRKGYLTDIAQQENIRLLAEDIHPISLLQQTDKVYCVTS
QMGFEALLCGKPVTTFGLPWYAGWGVCDDRHPDIAKLEQSGRRAGRTLTQLFAAAYLQYS
RYINPNTGQSGTIFDVIAYLARARHLNEYLRGNLYCIGVSLWKRAVIKPFFNVPACRLHF
VPTADKMLKINLPPDARLLAWGGGKETVIRLAEQLNLPLLRMEDGFIRSVGLGSNLVPPL
SLVIDDMGIYFDPARPSRLEHILQHRHFDEFDRETAQNLQRELIEANISKYNVGRTETTQ
RPSEKRILLVPGQVEDDASIRLGAPKICRNLDLLRTVRERNPDAYIIYKPHPDVVSGNRI
GAVPPEECARYADQTAAETDILTCLQHADEVHTMTSLTGFEALLRGKAVHCYGQPFYSGW
GLTCDEHPLPRRTRKLELWQLITGTLLHYPLYIHPDNQTMTDAATAAAILKKNKEIRKSG
KLKQSWPSKQLNKIRQLWRSLK

Enzyme Prediction     

No EC number prediction in MGYG000002119_01411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	283	679	4.6e-153	0.7424812030075187
GT107	20	325	2.9e-107	0.5582706766917294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	1	682	1	671	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	8.86e-159	376	632	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	8.99e-153	35	305	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.05e-103	378	632	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.26e-99	35	302	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ20334.1	0.0	1	678	1	681
ARD14822.1	0.0	1	682	21	704
AEQ62064.1	0.0	1	682	21	704
CCP19802.1	0.0	1	682	21	704
AAF40546.1	0.0	1	682	21	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	7.74e-107	6	354	5	352	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	2.30e-89	6	320	13	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	2.72e-80	333	633	3	301	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	0.0	1	682	21	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	0.0	1	682	21	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	2.98e-210	6	635	4	626	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	1.12e-61	338	632	80	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002119_01411.