CAZyme Information: MGYG000002113_00398

Basic Information

• Species: Anaerovibrio sp900548165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Anaerovibrio; Anaerovibrio sp900548165
• CAZyme ID: MGYG000002113_00398
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000002113_15|CGC1	55879.77	9.1547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002113	1986108	MAG	Mongolia	Asia

• Gene Location: Start: 5262; End: 6713 Strand: +

Full Sequence      

MTTVKKDLLTIGIVGFLLFMLGNWAIAITDPVESNYTLTAVEMLRSGDYISPRIYGNYWY
DKPAFFYWELIAAYKLMGVNEFASRFFPGVFGVLGLMMTYGFARKLYDRKTGLMAAGILG
TCFEYWLLSKTVITDLTLFVFFNAVLIFFFWGYRRGQRNYYYLCYLFAGLATLDKGPIGL
LLPGFVLTVFLCIRRDFKEFLYLRLPTGLVLYALVAGSWYYMMYTIHGMDFINNFLGVHN
FLRATQSEHPRWDVWWYYTMIFFAGCLPWCWTLPAAIIKAVKRQRLPEIDMTTGFLLTWA
LVVNVFYQCMATKYTTYTLPALLPIAILMARYLYQREVLVKRTVIGAVVVYGILTFALAI
PACSDEGYSGKNIAAAYKDVVKDDDLVVSYGDYKTSIVFYGQKMVYRLEKAESIPGMLPD
GKSWKAKNVMPFISFEELPKDKNVYLILNNRRFNSFEKDFDTSEWKLLADFEKARVYVRE
AVK

Enzyme Prediction     

No EC number prediction in MGYG000002113_00398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	360	9.6e-92	0.6481481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.02e-45	1	367	3	367	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.49e-26	31	336	31	336	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.38e-13	61	187	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.67e-06	33	218	32	222	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.004	81	173	111	206	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR69759.1	1.22e-152	6	468	2	465
AOH47263.1	1.71e-150	17	481	16	484
QNH54574.1	4.54e-150	18	468	17	465
AME04035.1	2.23e-147	18	479	17	481
AXL22207.1	7.40e-142	22	465	47	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.16e-26	28	328	54	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	3.86e-29	5	338	2	312	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	1.32e-26	27	337	24	325	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A6V1N8	9.49e-24	7	336	8	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q9HY61	1.71e-23	7	336	8	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
Q02R27	2.29e-23	7	336	8	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996624	0.003257	0.000038	0.000011	0.000009	0.000086

TMHMM  Annotations     

start	end
7	29
82	104
131	153
176	193
200	222
256	278
291	310
314	333
338	360