CAZyme Information: MGYG000002109_00608

Basic Information

• Species: UBA1232 sp900544815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900544815
• CAZyme ID: MGYG000002109_00608
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000002109_7|CGC1	62541.34	9.3409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002109	2245017	MAG	Mongolia	Asia

• Gene Location: Start: 44341; End: 45984 Strand: +

Full Sequence      

MKRAIYIFLLTVVCVFTLFLGNRVKPVDIMESRNLATAREMVVYGNYLNPTLNGEPRLEK
PPLPTWGAAAVESLFRGSIAWQRSLTGVMGSLWVIFTFLIAIELGSKQRQAFWIGLIMAT
CYGVMFMSRNATWDIWCHSMMSIAIFCYIKGIKSRSSAMVLFATAGCFMGLSFLSKGLIS
FYTLLLPFLITYHIVYRPSMRGKWVSACIMIIVALVVGGWWYMYLNISSGDAISSVIQKE
TTDWANHNTGPWYYYYLFFTESGIWCLYWLASLIYTFAHGWYKKEKLLVISALWTIIALI
LLSIPPEKKTRYLLPMMMPCALSVGSWFYVLYMQLKSNFTRIEGIAVFKIISSALSVIIT
AAGIALLFKPMGISISFGTVMLSLISIATGLFGIYVIFIKSNGRSLKFSCVKIRILMLIF
VVELCSITLFGMGSISKMVINSDMNRISDLREICRLNDYNTYYPVTEELRPEIMYAAGKR
IMPLDFDSADVANIERPYILILSKPVEEYPLLERFKVTKLQRYDANWWKKDSDNYNDNLV
KDIYFIE

Enzyme Prediction     

No EC number prediction in MGYG000002109_00608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	427	6e-59	0.7759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.24e-22	1	427	5	429	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	4.05e-07	60	220	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	1.48e-06	1	398	2	404	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	6.82e-04	30	224	31	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXI30826.1	2.49e-16	31	344	39	347
QSV47361.1	4.14e-16	18	315	19	314
CRI55271.1	2.40e-15	31	315	38	321
QDU59816.1	1.89e-14	25	327	31	338
BBB32874.1	3.86e-14	3	327	18	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCB9	1.47e-10	31	325	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q4K884	1.90e-09	31	326	65	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
B7VBN0	4.19e-09	31	325	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q02R27	9.67e-09	31	325	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q4KC80	9.67e-09	31	326	32	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.502348	0.491838	0.004875	0.000302	0.000262	0.000365

TMHMM  Annotations     

start	end
4	21
84	106
111	133
154	173
177	196
203	225
252	274
287	304
314	333
345	367
377	399
411	433