CAZyme Information: MGYG000002108_01403

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_01403
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		66729.53	9.2167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 4663; End: 6417 Strand: -

Full Sequence      

MKFLDKNLSLLIVVIVAMLMLLPFLGLSDFNTKGEPREAVVALSMLKDGNWILPVNNGMD
IPYKPPFFHYCIAVLSLLTGGVNEYTSRLPSALSLIAMTICCFCFYRKRMSTNVAVASAL
LLLTSFEVHRAGTNCRVDMMLTAFTVGALLLLYRWWERGSHGVPVLAVLCMSCATLTKGP
VGFILPCFVMGVFMLLRGEHFWKTFFKFVCFGLLSCILPLMWYVAAWIEGGQHFLDLVYE
ENIGRMTGSMSYESHEHSFPYNFFTLSTGWLPWTLLLLFSLFAKPWKGLKCRKTGEKLRI
RIMQIPPVKLFTWLSFLLVLFFYCLPSSKRSVYLLPCYPFMAVLIAQYIEWLWNSNRRGV
LRTYICVIASIGVIITLVYGALRFGLVPDTIFHGKHAAQNLAMLHALRDTQLGFLPFILM
LLPLITAADSIYLAFGKHTRDKKHIMAYCLFMPLVVLMMALDGIYQPTVLNTKSLRPMAE
YIQQTFPNEPLYQFVNDPMMHFFGADFYLGDKLDQFEKPVRTMVNNKVVVEKKTPTKGVL
VVSEDDFKVLAERHPEYNFVHVSTSKGRISELKENISFYRFSVK

Enzyme Prediction     

No EC number prediction in MGYG000002108_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	527	7.8e-84	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.18e-34	1	392	1	379	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.45e-12	6	378	5	365	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.21e-09	64	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4745	COG4745	4.08e-06	8	202	16	201	Predicted membrane-bound mannosyltransferase [General function prediction only].
pfam10131	PTPS_related	8.02e-06	63	409	3	332	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	1.39e-35	7	350	7	340
QTL97755.1	1.49e-26	8	422	20	425
ACN14933.1	4.95e-26	35	358	38	347
CBK43751.1	6.95e-26	6	440	23	456
BBB92576.1	3.26e-25	5	517	5	468

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.00e-23	18	388	6	363	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	3.21e-17	7	359	7	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
C5BDQ8	4.34e-17	35	359	32	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
O67601	3.00e-16	29	349	24	307	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A4WAM1	5.53e-16	35	357	32	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.983223	0.015444	0.000364	0.000064	0.000043	0.000889

TMHMM  Annotations     

start	end
7	26
89	106
139	156
176	198
205	227
261	283
304	326
331	353
360	382
413	435
447	469