CAZyme Information: MGYG000002092_00646

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002092_00646
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841		95364.33	6.7383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002092	1925182	MAG	Mongolia	Asia

• Gene Location: Start: 2784; End: 5309 Strand: -

Full Sequence      

MNSNTRRHVVALAMAVWPLLNAVAGEWIRINQQGYLPKATKVAVLMCEEESAVKTFEIRD
AFTDKVVFTSDEVKHTGPLGNMKSTFRLNFSSLCHPGTYYIKVGTCRSEVFPINGQVYHG
TADYTLHYMRQQRCGWNPYIKDYCHQKDGIIINHPTKEGQHLDVRGGWHDAADLLQYTTT
SANAIYQMMFAYMQNPTAFADRYKADGTPGSNGVPDIVDEIYWGLQWLDRMNPERGELYN
QIADDRDHVAMKLPNYDPADYGWGKNAERPVYFVDGKPQQRGKFKNATMGAASTAGKFAS
DFALGSQILKPFYPDFAAKIGGKAEDAYQVGLDKPGNAQTVSVVSPYIYEEDNWVDDMEL
GAMELYRKTGDKKYLSQAVEYGRREPFTPWMGADSARHYQWYPFMNMGHYQIAKLSDNQR
LKDEFIRNLRTGIERTYERGKSHPFLWGVPGIWCSNNLTTAMLTQCILYRQLTGDRTYEE
MEGALRDWLLGCNPWGTSMIVELPKGGTFPTQPHSGYVYLNHGTTTGGLVDGPVYSTIFG
SLRGVSLTTGPRAAEAHNYERFQPGDVVYHDNMSDYSTNEPTMDGTASLTFPFSVYESEG
REQTGIDSDNNVYEEAGGIIKGDPKKRQISLVFTADQWADGADDIMSALKKNNIKGAFFF
TGRFFELHADVVRRLVADGHYVGSHSYGHLLYAPWDNRDSLLVTRQQFMDDMKKSYATLS
RFGISKETAPYFIPPYEYYNSTVCSWAKQMGLQIINFTPGTGTNADYTTPDMKNYRSSDT
IMQRLLAYEHDHTLNGHFLMVHFGTSPARTDKFYKQLPQMIKELRQKGYTFVSVEQMIKG
K

Enzyme Prediction     

No EC number prediction in MGYG000002092_00646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	118	591	4.9e-71	0.9880382775119617
CE4	623	755	9.9e-20	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	6.22e-58	126	591	7	372	Glycosyl hydrolase family 9.
cd10950	CE4_BsYlxY_like	6.45e-29	622	838	1	188	Putative catalytic NodB homology domain of uncharacterized protein YlxY from Bacillus subtilis and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis putative polysaccharide deacetylase BsYlxY, encoded by the ylxY gene, which is a member of the carbohydrate esterase 4 (CE4) superfamily. Although its biological function still remains unknown, BsYlxY shows high sequence homology to the catalytic domain of Bacillus subtilis pdaB gene encoding a putative polysaccharide deacetylase (BsPdaB), which is essential for the maintenance of spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. However, disruption of the ylxY gene in B. subtilis did not cause any sporulation defect. Moreover, the Asp residue in the classical His-His-Asp zinc-binding motif of CE4 esterases is mutated to a Val residue in this family. Other catalytically relevant residues of CE4 esterases are also not conserved, which suggest that members of this family may be inactive.
cd10917	CE4_NodB_like_6s_7s	4.54e-28	627	825	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
pfam02927	CelD_N	2.21e-23	27	108	2	83	Cellulase N-terminal ig-like domain.
cd10948	CE4_BsPdaA_like	1.20e-21	597	834	10	223	Catalytic NodB homology domain of Bacillus subtilis polysaccharide deacetylase PdaA, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis pdaA gene encoding polysaccharide deacetylase BsPdaA, which is a member of the carbohydrate esterase 4 (CE4) superfamily. BsPdaA deacetylates peptidoglycan N-acetylmuramic acid (MurNAc) residues to facilitate the formation of muramic delta-lactam, which is required for recognition of germination lytic enzymes. BsPdaA deficiency leads to the absence of muramic delta-lactam residues in the spore cortex. Like other CE4 esterases, BsPdaA consists of a single catalytic NodB homology domain that appears to adopt a deformed (beta/alpha)8 barrel fold with a putative substrate binding groove harboring the majority of the conserved residues. It utilizes a general acid/base catalytic mechanism involving a tetrahedral transition intermediate, where a water molecule functions as the nucleophile tightly associated to the zinc cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI47497.1	0.0	20	838	17	834
QCQ33880.1	0.0	20	838	17	834
QKH86859.1	0.0	20	838	17	834
QLK84487.1	0.0	20	838	17	834
QCQ47069.1	0.0	20	838	17	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	1.35e-37	12	591	2	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	1.36e-23	36	591	2	534	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
6DHT_A	2.96e-22	18	589	8	557	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
5U0H_A	2.79e-20	36	591	2	534	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
1UT9_A	1.23e-15	28	514	7	530	ChainA, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT3	1.05e-22	12	589	16	571	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P14090	4.25e-19	25	600	338	911	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
Q05156	4.88e-18	25	600	182	746	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P23658	1.22e-17	30	594	6	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
P50865	1.95e-15	619	838	49	243	Probable polysaccharide deacetylase PdaB OS=Bacillus subtilis (strain 168) OX=224308 GN=pdaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008675	0.961050	0.000972	0.028424	0.000520	0.000326

TMHMM  Annotations     

start	end
9	28