CAZyme Information: MGYG000002092_00402

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002092_00402
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000002092_27|CGC1	43182.77	7.1055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002092	1925182	MAG	Mongolia	Asia

• Gene Location: Start: 8126; End: 9274 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASRLMLSLKKEDPHAEFRFFGGDLMSAVGGTRVRHYRELAYMGFV
PVLLHLRTILGNMKMCKRDIVEWGPDVVILVDYPGFNLGIAKYVRAHTHIPVYYYISPKI
WAWKEWRIKSIRRDVSEMFSILPFEVDFYEEKHNYPIHYVGNPTAEEVAEFKESHGETFE
EFCRDNVLDTRPIIALLAGSRRQEVKDNLPAMIEAASAFADRYQLVLAKAPSLDDDYYAP
FLEGKDVKAVGGKTYDLLAHSTAALVTSGTATLETALFGVPQTVCYKTPVPRLIRFAFNH
IIKVPFISLVNLIAGREVVSELFAERFTVSQIREDLRSVLPGGSRREAMLDGYAAVAERL
GHTSAPDNAAREMVKLLQGEKR

Enzyme Prediction     

No EC number prediction in MGYG000002092_00402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	1.1e-108	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.28e-102	1	382	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.54e-101	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.01e-70	4	372	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.50e-60	5	376	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.16e-48	1	378	2	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB84094.1	4.55e-194	1	381	1	380
BCS84470.1	3.25e-193	1	377	1	384
QUB91228.1	4.30e-193	1	381	1	380
QUB87885.1	2.48e-192	1	381	1	380
AEA21009.1	2.48e-192	1	381	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.99e-35	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.30e-35	5	378	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.05e-69	6	377	10	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	2.55e-64	5	382	11	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3JAC1	4.24e-63	5	380	10	381	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
B3E4H8	5.87e-62	5	378	11	381	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q02AZ6	7.83e-62	2	380	3	376	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002092_00402.