CAZyme Information: MGYG000002089_00168

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000002089_00168
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36615.27	5.4329

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002089	1650359	MAG	Mongolia	Asia

• Gene Location: Start: 4966; End: 5925 Strand: -

Full Sequence      

MKFGEINRTIRLGIIGFGWRGYGQTETLLEMPDVEITAVCDVYPDRVELGKEMVKKTRGK
ECFGTTDYREVNRQEDVDAVVVMTDWSTHIRIAIDAMNCGKDVAIEVCPASSVQECWDLV
HTVEDTGRKFMFLENQCYDDQTLALFNMVRHGVFGELVYAAGGYQHDLREEIGNGDIKRH
YRQRNFFHRNGEIYPTHELGFIAKALGINRGNRMMALTAMTTKAVGLHEWYEKNRTDRPE
LARQRVAQGDIAGVMIRCANGEMIYMTHDCTTPHPYNQDFRLQGSKGTWRELNHSIYIEG
ESPKDEWGEGQWEPDDASR

Enzyme Prediction     

No EC number prediction in MGYG000002089_00168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	8	309	7.5e-107	0.7694235588972431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.06e-21	8	319	2	289	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.93e-14	10	131	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK06046	PRK06046	0.002	11	101	131	229	alanine dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF80535.1	1.90e-112	8	314	7	313
AEE95391.1	4.90e-101	12	307	11	306
ANY74959.1	1.70e-97	4	307	6	309
QTH41090.1	6.99e-96	8	307	8	307
QUO31207.1	1.04e-93	8	307	2	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.02e-66	8	300	19	331	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.06e-43	10	311	43	351	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.57e-07	11	175	7	170	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
6Z3B_B	2.88e-06	8	159	2	145	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]
6Z3B_A	2.91e-06	8	159	4	147	Lowresolution structure of RgNanOx [[Ruminococcus] gnavus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	3.84e-69	8	309	32	357	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	6.22e-67	4	312	44	377	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8F7	1.10e-65	8	300	19	331	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	2.16e-64	4	307	47	373	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	2.42e-60	5	309	56	365	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002089_00168.