CAZyme Information: MGYG000002082_01598

Basic Information

• Species: Alistipes sp900544265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900544265
• CAZyme ID: MGYG000002082_01598
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000002082_11|CGC1	56097.31	5.058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002082	2573115	MAG	Netherlands	Europe

• Gene Location: Start: 21131; End: 22627 Strand: +

Full Sequence      

MEFKFRIYTRMLLMLVFMAPVSCAASDKFYADNVPPTGNPIEENTEYFEKFVDLGSATLE
EKVDMAARLIPTPAQLEWQRWELTAFIHFTVNTWTGQEWGDGTENPDVFNPGELDTDQWV
RTLKDAGFKLVMLTAKHHDGFCLWPTKTTSHSVASSSWKDGKGDVVQMLRESCDKYGMKL
GLYVSPWDRNASCYGTPEYDDMFVAQITELLTWYGDVAEMWFDGANGSSIPGTPTHTFDW
PRYMKAVKDLQPHVVTAIMGDDIRWVGNEAGRGREQEWSSVALQPAPLKNPATVVSGLEA
KSADLGSRDVLSRAKALYWYPAEVDVSIRNGWFYHADQQPKSLETLKQIYFASVGSNAVL
LLNIPPDTRGLLPDADVQRLGEFGTWIRESFTDNRVIGGDGAWQAASGKSREFDVQPGQL
FNVVMLQEDIARGQRVERFRVEITSDGSTWETIAQGITIGHKRLVKLDTPRTARNLRVTI
EQTRRTANLSNVGLYYAK

Enzyme Prediction     

No EC number prediction in MGYG000002082_01598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	72	388	2.2e-77	0.8641618497109826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.39e-61	71	464	11	400	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.93e-33	107	388	77	329	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.42e-26	86	388	31	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	3.89e-04	400	480	23	112	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL07679.1	5.56e-222	47	495	32	483
AKA52690.1	1.42e-192	37	498	16	480
BAD49988.1	1.42e-192	37	498	16	480
QUU03701.1	8.13e-192	37	498	16	480
QCT79583.1	8.13e-192	37	498	16	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	3.97e-176	42	498	2	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.82e-108	67	468	15	450	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	6.10e-107	67	468	17	452	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.28e-106	67	468	15	450	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.57e-89	70	497	38	465	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.92e-99	70	498	37	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	3.06e-94	70	495	39	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	2.86e-08	114	404	105	367	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q6AYS4	5.00e-08	78	417	70	374	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	6.65e-08	78	417	72	376	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005190	0.492767	0.501351	0.000280	0.000194	0.000188

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002082_01598.