CAZyme Information: MGYG000002080_01494

Basic Information

• Species: Prevotella sp900544825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544825
• CAZyme ID: MGYG000002080_01494
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002080_27|CGC2	41851.52	9.1971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002080	3221264	MAG	Netherlands	Europe

• Gene Location: Start: 40836; End: 41954 Strand: -

Full Sequence      

MKTEHILVIRFSAMGDVAMTVPVIYSLAKQYPHVRITVLSRSFARPFFENLAPNVGFMEA
DLKGEYKGVKGLNALYRRLIAKQFTAIADLHSVLRSSYLRMRFNLSNFKVAHIDKHRKGK
RKLVASSGKVMEKQPSSFQNYADVFAKLGYPVQMDFTSLFPEEGGDLSLLPEQVFQVTVD
NNKDKSTVINKDAHNPAEPWIGLAPFAAHEGKIYPVQQMEKVVERLIHNHPHCRIFLFGG
GQTETPVMDAWEEKYPQVVNASGKLHGISDELILMSHLRLMISMDSGNMHLASLVNIPVV
SIWGATHPYAGFMGWHQSPDNAVQLDMPCRPCSIYGNKPCMRGDFACMKNISPELIVEKV
EKVLNENAKKSH

Enzyme Prediction     

No EC number prediction in MGYG000002080_01494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	342	2.7e-33	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.11e-52	5	362	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.95e-39	5	367	3	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	1.20e-16	6	364	2	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	3.72e-11	74	332	3	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.70e-04	2	330	4	317	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67212.1	8.22e-208	1	366	1	360
BCS85074.1	4.04e-168	1	364	1	347
VEH14583.1	3.32e-166	4	365	2	346
QUB47303.1	4.59e-160	1	366	1	349
QUB75601.1	7.03e-159	1	364	1	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.72e-06	5	308	2	292	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002080_01494.