CAZyme Information: MGYG000002077_01437

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000002077_01437
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42681.02	9.1598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002077	1933008	MAG	Netherlands	Europe

• Gene Location: Start: 39333; End: 40457 Strand: -

Full Sequence      

MKKIFIITGEYSGDIHASKVVKELHALGSDVEIEGIGGLNLEAQGVKLFANQEKMSAVGL
SPKILIDHYKLGKSLVNYLKNEYKPDLVLLIDYGAFNLSIARFLKKAGIKVFYYIPPQVW
ASRKYRIKLIKKFVDKVLCIFPFEKPLYAQYGIDTHYCGHPLVAQLPPPAGRREFFRKHD
LDFDKKLVSVFPGSREFELKHLMPVFKDTVRRLKERHPDLQFCLSHAPNLSDDIYNKYLG
DTDIKVIKGENQALLSVSDALILASGTVALEACLYKTPMIIAYRGPQFFYWVYLLVRCIK
RVSLPNIIADKSIVPEILQNDVKPLNITYEIEELLYNKEKRDYAISELGKVKEMLSDKNS
ALEVAKVIDTELFS

Enzyme Prediction     

No EC number prediction in MGYG000002077_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1.1e-105	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.39e-122	1	371	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.89e-106	1	368	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.68e-79	4	341	1	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.06e-65	4	340	8	350	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.27e-44	1	369	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	6.40e-183	1	374	1	374
AKQ33376.1	1.00e-81	2	367	6	371
AEH45383.1	1.33e-76	3	367	10	371
ACJ20785.1	7.38e-75	2	374	4	376
EAX32940.1	7.38e-75	2	374	4	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.30e-46	4	337	9	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.81e-46	4	337	9	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J9H1	1.48e-75	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	4.15e-75	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	5.86e-75	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	5.86e-75	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
A9KC41	5.86e-75	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002077_01437.