CAZyme Information: MGYG000002074_00642

Basic Information

• Species: QAMH01 sp900556425
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; QAMH01; QAMH01 sp900556425
• CAZyme ID: MGYG000002074_00642
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		72618.15	4.8069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002074	2149037	MAG	Netherlands	Europe

• Gene Location: Start: 56772; End: 58682 Strand: +

Full Sequence      

MQRHKLSNVLLENSWQFFRAPAMYCSSNAPVACGDSAEGEWSLQGPGTFDFTTFFNALPT
SKWMRYTNAREFFLHLELKGAACAFTQTRADSYTWHAEPLDTTRRDIAASEEWVALDIPL
ELNDDVLVGFLLESQGAVQIHNSYYYTQIDDESIRPVELALCTTTFKNENYILPNVELVR
TRVIETDEPISEHFSMHVVDNGRTLDAKDVESERIFLHPNPNAGGAGGFARGMIEAMEQA
PRATHVLLMDDDVSISPESIIRTFNLLSIVNDDYSEAFLSGAMMSMDQPNLRYEDVGFVA
CNGKYFPAKNLAYVDVLHDCVANEAFVHCSPEEAGYDADRMSQSYAAWWYCVIPVSVIDR
EGLPLPIFVRTDDVEYSLRAHAKIMTMNGICVWHAPFKQRYSAAVERYQMPRNVLIGQFT
SGMAPLSDFIGDLKIGFELELKKYNYDNAALVLDAFEDFLKGPSFIMEKGAAERSYLDHL
KKAEKLLPLDDIKEDALALGVDLDTIPATQFDHENYERDDHRSFVERIRDNMTVNGHRMV
RGDYYDKGSVAVISAAGWLYPVDELRKKEYIIAIDAPSKKGIIRKMDKERFNQLWDRFHR
DMVEFRANKDRLRKEYEAARPAMTSLPFWKRYLGID

Enzyme Prediction     

No EC number prediction in MGYG000002074_00642.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.26e-04	198	394	37	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	8.44e-04	243	416	76	235	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam13641	Glyco_tranf_2_3	0.008	233	412	78	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam17994	Glft2_N	0.008	51	93	48	84	Galactofuranosyltransferase 2 N-terminal. This is the N-terminal beta-barrel domain found in the polymerizing galactofuranosyltransferase GlfT2 (Rv3808c). This enzyme synthesizes the bulk of the galactan portion of the mycolyl-arabinogalactan complex, which is the largest component of the mycobacterial cell wall such as in Mycobacterium tuberculosis. The N-terminal domain contains two short helices preceding a 10-stranded beta-sandwich with jelly roll topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT48577.1	8.48e-225	1	635	9	642
BBH50617.1	8.24e-211	3	634	2	622
QUC04258.1	9.25e-207	1	636	1	635
QQQ90891.1	4.16e-189	1	636	1	623
ANU43247.1	4.16e-189	1	636	1	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	1.90e-30	6	466	29	492	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R628	2.89e-32	6	633	20	636	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1
O53585	9.44e-30	6	466	9	472	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002074_00642.