CAZyme Information: MGYG000002064_00365

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000002064_00365
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		58117.94	5.3891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002064	2319791	MAG	China	Asia

• Gene Location: Start: 2561; End: 4105 Strand: +

Full Sequence      

MRSRISPEELLEGFDNHVRSFRLKRGFSCTMANAPDGTGYSRVFMADNEDLVVDEMPEGL
DFASFIRVCRHDWVGKKGFAGGEWPAITRSAWFYDWGAGAASTADYEYVPMRHNRWWDSW
ENIGSRTATSSVLGFNEPDHADQSDLGTDIVIDLWPEMMKSGLRIGSPAPDNINKDWLRE
FLAKADSLNYRVDFVATHMYLNSQNPYTLADNIGRLCRESYGGRPMWITEWNNGANWTNE
RWPDAKGPQRDADFNIVYDADGNTTEVARPHTEANSAVQCQWLAKALDAFDKCDWLERHA
FYTWVEDARAIVLDGRLTPAGKIFAEFNSRPAFNRSTEYVHTWRIAAPWVYGINTNRTCV
RVNFYDTNGETAEGYIVERRIDGGAWKQIAYIRPGVDYKLGKKTYFADRDMPGGFTEYRM
KAVSYKGTESIYSRTIGKQVAAGVAAVVAADEFAVRCEHGTVVITAEKAGHIDIYAVDGR
LVRSLDYPEGSTTIEGLPVGLYLARSHRFFVAPE

Enzyme Prediction     

No EC number prediction in MGYG000002064_00365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	90	323	7.6e-34	0.9508928571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	3.49e-24	92	324	20	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam01229	Glyco_hydro_39	0.001	135	294	155	318	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC19783.1	8.61e-106	11	436	486	924
APZ45921.1	8.61e-106	11	436	486	924
AXY72824.1	1.59e-104	14	433	512	904
BAV05333.1	1.68e-98	11	502	659	1141
AEV99551.1	8.81e-90	14	436	534	943

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	5.49e-18	76	231	25	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.36e-17	76	231	25	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	2.50e-17	76	200	25	162	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	3.38e-17	76	231	25	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002064_00365.