CAZyme Information: MGYG000002063_00131

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002063_00131
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000002063_3|CGC2	37144.02	7.6739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002063	2224261	MAG	China	Asia

• Gene Location: Start: 52434; End: 53411 Strand: +

Full Sequence      

MKRILTLLTIMLATATGTLAADKYDNPDTIVVSRDGTGEFRTIGEAIEVCRAFMDYHKVI
YVKRGVYKEKLIVPQWLTNIEILGEDRDATVITYDDHANIPNPATGRGIGTFRTYTVKVE
GNSITFRNITIENNSARLGQAVALHTEGDRLVFVNCRLLGHQDTVYTGVAGTRLFFRDCY
IEGTTDFIFGPSTAWFENCEIRSRADSYITAASTPKDRPYGYIFNRCRLTADANVTKVYL
GRPWRDYGYTLFIDCEMGRHIRPEGWHHWQKERQQTARYMEYGNSGEGAATDRRAPWTRR
LTKKEAAKITMEEVFSIDDKWTPEP

Enzyme Prediction     

No EC number prediction in MGYG000002063_00131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	315	2.6e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	5.77e-79	30	310	2	290	Pectinesterase.
PLN02773	PLN02773	6.42e-73	32	322	9	303	pectinesterase
COG4677	PemB	2.73e-68	5	316	62	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02197	PLN02197	8.82e-63	29	309	276	562	pectinesterase
PLN02682	PLN02682	2.20e-58	29	306	70	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	2.10e-182	1	323	1	322
ADE82952.1	2.10e-182	1	323	1	322
BCS84477.1	1.23e-163	20	323	19	323
AGB28242.1	5.14e-160	7	323	6	323
QJR97878.1	4.99e-159	23	324	15	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.89e-43	30	297	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.10e-42	31	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	5.30e-36	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.83e-35	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.03e-31	33	323	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.32e-52	32	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.74e-52	29	323	272	569	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	5.00e-52	29	309	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	2.84e-50	29	323	259	556	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
O80722	7.13e-49	31	309	278	562	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000251	0.999104	0.000162	0.000158	0.000149	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002063_00131.