CAZyme Information: MGYG000002062_00422

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000002062_00422
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000002062_5|CGC1	34031.28	7.3219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002062	2018168	MAG	China	Asia

• Gene Location: Start: 22320; End: 23258 Strand: -

Full Sequence      

MSTILCRLPNHVGDCCMTLPALRLLEASGFTPMLAGKRWAEDLMSGMGWRFDPIEGHVTE
DLTRIRYLSQHVGPDPRGLLFPNSFSSALLFSVGRLKSTGLATDGRRFLLEHAIPEPGPM
HEVERFFYLAHEAIKAWGGTPAWDKVPEELGLKVLARHEAAARNLSNEHNLPAKFALLAP
VARGMHHGQVKAWAHFNELCKPLRDLGVEPIVFPSQHEVDEARAACPDARILTPTTLGNY
AALARQAAIVIANDSGVSHLAAAVGAKQITLIGVTDIDRTRPWNPKAVVLGDAKKGWPSV
EEVVSTMQGMLA

Enzyme Prediction     

No EC number prediction in MGYG000002062_00422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	81	292	2e-26	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	6.43e-29	77	291	15	228	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	1.66e-19	1	289	1	294	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.14e-17	3	291	1	241	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10916	PRK10916	1.30e-06	77	297	83	323	ADP-heptose--LPS heptosyltransferase RfaF.
PRK10422	PRK10422	2.48e-05	155	288	162	304	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22597.1	2.90e-155	1	311	1	311
QDA55160.1	5.36e-153	1	308	1	307
QQS89241.1	5.77e-149	4	308	6	310
ANU65198.1	9.28e-119	1	312	1	310
QQQ96353.1	9.28e-119	1	312	1	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	7.89e-09	9	297	8	323	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37692	2.18e-10	9	297	8	323	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	5.57e-09	9	290	8	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002062_00422.