CAZyme Information: MGYG000002061_00848

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_00848
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		38179.89	4.8652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 32152; End: 33174 Strand: -

Full Sequence      

MQLKLLEKGPIYAIESAQTPSCHASTIVRMTDGRLAAAWFGGSNESNPDVCIWFSVREAN
GWTTPVRVTPDNNIAHWNPVLYQDPLSGLLWLFYKEGLTPRCWHTMVTRSSDCGAAWSEP
EELVTGDTFPRGPVKDKLICLSDGTWLAPSSEEDDLHRWMLFLDRSEDHGKSWGRTDYVP
MQLEGSDRVYASISEMPAKSGGLIQPTLWEEKDHPGHVHLLARSSLGHIYRADSTDFGKT
WSCAYPTDQPNNNSGIDVVRMDDGTLALIFNPVAANWGDRFPISLMLSKDNGKTWGHRLD
LETEPGEYSYPAIIADGDMLYMTYTFQRQTVQFAAVQVCR

Enzyme Prediction     

No EC number prediction in MGYG000002061_00848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	16	316	2.8e-26	0.8801169590643275

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.23e-87	33	322	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	3.96e-70	1	333	12	368	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	2.40e-47	10	328	2	326	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam15902	Sortilin-Vps10	3.05e-04	165	295	5	109	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL13497.1	6.43e-112	10	338	13	346
AUV02432.1	8.47e-110	10	338	13	346
AJQ78254.1	2.24e-107	1	337	1	345
ALS21221.1	6.93e-107	21	338	19	337
QWT42658.1	4.30e-105	21	336	21	344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_00848.