CAZyme Information: MGYG000002056_00390

Basic Information

• Species: CAG-115 sp000432175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp000432175
• CAZyme ID: MGYG000002056_00390
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000002056_3|CGC2	69033.14	5.3994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002056	2653439	MAG	China	Asia

• Gene Location: Start: 86934; End: 88745 Strand: -

Full Sequence      

MLNNAKSGTVRILPGVFRERMDVNRRYLMELDTNCLLQNFYLEAGIILPGLQVVDDPATA
NIHWGWEAPVCQLRGHFLGHWISAAAKLIASDGDQELKVKMDRIISELARCQELNGGEWV
GSIPEKYFTRLINNQYIWSPQYVMHKTIMGLSDAYIYAGNTQALDILAHLSDWYIRWTER
AAGTNPHAVYAGEEAGMLEVWAQLYQLTSDEKYLTLARRYADAGLFRKLKEGRDSLTNCH
ANASIPFTHGAARMYEITGDSDWLEVIKLFWKFAVTDRGMYSTTGMNAGEFWVPPHLQGH
FIGSNDQEFCTVYNMVRTASFLFRYTGEKQYADYIERALYNGFLAQQNAETGMPTYFLPL
AAGSRKKWGTRTRDFWCCHGTMVQAQTLYPELIYFTEGSRLIVSQYIPSRFEGDVNGHSV
TFEQTTGMKYYNDQAFFDEKDDGQMSRWLLKFSVKCADNAEFTLSFRVPEWTAGAPEVEL
NGKKMTAPVKDGYINITADWSDSTLQIFFPSELRMERLPDMPELGAVVDGPIVLAGLTSA
DRGIKGADRLSEQFMPQLEHTYGTFPWRQNSWRTRNQPENIMFRPLYEIKDEEYTVYFTG
KND

Enzyme Prediction     

No EC number prediction in MGYG000002056_00390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	10	535	1.7e-160	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.99e-121	10	535	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.16e-80	9	556	11	516	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	1.95e-05	189	339	408	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	3.74e-05	195	287	595	693	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04434	LanC_like	0.003	112	357	66	325	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50077.1	1.20e-280	1	598	1	600
QTE68365.1	3.43e-267	1	599	1	600
QTE71079.1	2.60e-266	1	602	1	601
QUA54004.1	5.84e-266	1	600	1	602
QUC68168.1	4.27e-265	1	601	1	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.79e-61	10	541	33	566	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.30e-58	10	541	33	566	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	4.06e-21	81	557	82	577	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.10e-19	81	557	82	577	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000020	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002056_00390.