CAZyme Information: MGYG000002049_01585

Basic Information

• Species: CAG-485 sp900556595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900556595
• CAZyme ID: MGYG000002049_01585
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		46798.12	6.311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002049	1913681	MAG	China	Asia

• Gene Location: Start: 100; End: 1347 Strand: +

Full Sequence      

MNLKNLIISAFALAAIAFSMSATHYVGGDISLLPDYEKSKAQYKDFGGKRIADLLPWLHE
QGMNAMRVRLFNDPSKYTGDDKNNVVQDLAYIRPLCKQIVEDGFDLMLDFHYSDYWADPA
KQTTPDAWKNLDDATLCDSVYAFTRHTLEVLKADGAAPKFIQPGNEISYGLLWGPEGTSD
KNKKKVYMNNPANWERFGNLLKAAVKACREVCPDAQIVIHTERVAKLDVQRYFYNQMAKL
GVDYDIIGISYYPYFHGGLNVLDAALADLSKNFDKQIMLVETGYPYAWEVPGTTHDNTAA
WPYTLAGQEKFAKDVVATLDKYPKADGLFWWWMEYNAKGTSLSGWYNAPLFDSRDGKATP
ALKAICSYATSGVESIVVDSHEISGDNKWYDISGREVKEPLNRGIYIRNGKKIIR

Enzyme Prediction     

No EC number prediction in MGYG000002049_01585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	364	2.6e-88	0.9912280701754386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	9.79e-83	25	364	1	332	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.81e-70	6	372	18	397	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
cd19608	GH113_mannanase-like	0.007	245	347	181	296	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	1.89e-127	1	413	1	413
VEH14955.1	8.20e-122	21	369	44	398
QVJ80245.1	1.05e-98	22	413	22	420
AGB28452.1	3.12e-91	22	415	20	445
QUT66820.1	7.16e-85	4	365	3	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	7.18e-57	27	363	53	389	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	5.37e-44	27	331	27	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	3.92e-43	27	331	27	320	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1FHL_A	2.06e-37	22	343	1	312	CrystalStructure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	3.01e-36	9	341	5	326	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.31e-52	26	364	8	348	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	1.59e-43	4	343	4	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q65CX5	4.88e-43	27	331	52	345	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
Q4WJ80	8.69e-42	4	343	4	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
B0XPR3	6.39e-41	4	343	4	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.051386	0.943564	0.004134	0.000293	0.000296	0.000313

TMHMM  Annotations     

start	end
5	27