CAZyme Information: MGYG000002049_01454

Basic Information

• Species: CAG-485 sp900556595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900556595
• CAZyme ID: MGYG000002049_01454
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		85513.34	5.7665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002049	1913681	MAG	China	Asia

• Gene Location: Start: 1403; End: 3706 Strand: -

Full Sequence      

MRYLNYFMLTMGMAAGSMAFASDPVIVQTDAYCWAGDTIFQNEFKAWAVNPYELRSTYKG
RPGYFMPIEQKWTRKNDLSSYPKLKSTNTLHEAIYNMALDEMVNAVEPDTTLRTGKEWSG
VWTRDVSYSIILSMAALQPEASMVSLMKKVNPSGQIIQDTGSGGAWPISTDRMVWALAAY
EIYKVTGDKEWVKKVYPIAVRSLEKDEKTVMSPRGLVKGETSFMDWREQSYPRWMQTVDI
SQSEAMGTNVMYAAALKAVGEMAEVLGKKKEAAKWFEKSDALAANIDKTFWMPDKGYYGM
YTYGRDNKILNPRAETLGEALAILYDIAPAERHKSISENNPHTPFGPAIFYPQIPDIPNY
HNNALWPWVGSYWTLAQAKAGNEKGVLEGIGSVFRPAALFCTNKENFNLDNGDIYTELNS
SNMLWCLAGNIALTQQVLFGVHFEKDGLRIQPFVPEALAGTRTLSNFPYRGARLNITVEG
YGDRVKELIVNGKSLYPEKGKVIPAKMLKGNVDILVKMNCEPIPAMKVNNVPNLKTPLMP
ITWLANNPALDGEGVPVNNELQWNPIEYIAKYIVLKDGEPVAETRETTYAATTPGEWQVI
GVAGDGTQSFASEPRSNRPVENYQFANEATAILSPEACNLPADGVKGFTGKGFVELDKSS
APLETVVEIPETGVYTIYFRYANGNGPVNTENKAGIRTLTLDGNKAATFVFPHRGVGNWN
DWGESNHVALPLEKGRHTLGVIYLPEDENMNIHTNHFLLDRVSVEKR

Enzyme Prediction     

No EC number prediction in MGYG000002049_01454.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	3.05e-15	647	747	22	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	1.39e-12	118	377	281	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17389	Bac_rhamnosid6H	1.64e-10	162	346	78	265	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04082	CBM35_pectate_lyase-like	4.38e-10	647	739	21	106	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam06202	GDE_C	1.39e-08	169	397	82	331	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKQ46615.1	6.04e-217	72	766	228	904
AWG27199.1	7.23e-210	52	766	196	892
QKG56937.1	3.04e-209	52	766	211	906
AHJ97374.1	1.01e-208	72	766	224	901
QTE38578.1	1.02e-208	61	760	203	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WNL_A	3.38e-06	647	743	405	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	3.38e-06	647	743	405	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNK_A	3.40e-06	647	743	424	513	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000462	0.998691	0.000258	0.000202	0.000202	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002049_01454.