CAZyme Information: MGYG000002042_01390

Basic Information

• Species: CAG-110 sp900762935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900762935
• CAZyme ID: MGYG000002042_01390
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		24135.48	6.0755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002042	2052895	MAG	China	Asia

• Gene Location: Start: 11436; End: 12077 Strand: -

Full Sequence      

MLESRCFEKEIVRKASLPYLIYLPPDYDGKKEFPLLVFLHGAGERGDDLSLVARHGPFKH
AAAGEDSPFVMVGPQCPQGRYWGNYLETLNDFLDEILETYRIDRNRVYLTGLSMGGTGTW
HWLLANPERFAAAAPVCGTGVCWFAEKVVHTPLWVFHGALDDVVPVEESLNMVRRIRQQG
GQPKLTVYPDVGHGAWEYAYSRELTDWLAAQHR

Enzyme Prediction     

No EC number prediction in MGYG000002042_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	15	198	3.7e-31	0.9030837004405287

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	8.42e-44	17	213	174	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	3.26e-20	17	211	378	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG3509	LpqC	3.58e-11	17	165	47	205	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
pfam00326	Peptidase_S9	1.47e-10	82	195	40	189	Prolyl oligopeptidase family.
COG0400	YpfH	5.83e-10	16	193	1	188	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU56037.1	7.37e-57	4	213	788	1007
QJW99051.1	1.28e-51	2	213	29	240
VTR91196.1	3.78e-51	2	213	28	239
ABS60377.1	7.69e-39	1	213	9	245
BCI61582.1	1.33e-38	10	211	818	1041

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	4.46e-42	15	213	156	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	4.27e-34	11	213	15	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	9.92e-29	22	213	70	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7EP9_A	1.66e-09	19	134	421	540	ChainA, S9 family peptidase [Fusobacterium nucleatum],7EP9_B Chain B, S9 family peptidase [Fusobacterium nucleatum],7EP9_C Chain C, S9 family peptidase [Fusobacterium nucleatum],7EP9_G Chain G, S9 family peptidase [Fusobacterium nucleatum]
5TXC_A	3.66e-07	21	133	419	546	AtxE2Isopeptidase - APO [Asticcacaulis excentricus CB 48],5TXC_B AtxE2 Isopeptidase - APO [Asticcacaulis excentricus CB 48]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8YG19	8.21e-10	34	179	73	218	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
E8RUP5	2.00e-06	21	133	419	546	Lasso peptide isopeptidase AtxE2 OS=Asticcacaulis excentricus (strain ATCC 15261 / DSM 4724 / KCTC 12464 / NCIMB 9791 / VKM B-1370 / CB 48) OX=573065 GN=atxE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002042_01390.