CAZyme Information: MGYG000002039_01353

Basic Information

• Species: UMGS966 sp900761965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS966; UMGS966 sp900761965
• CAZyme ID: MGYG000002039_01353
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
138	MGYG000002039_180|CGC1	15413.56	9.6972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002039	1613365	MAG	China	Asia

• Gene Location: Start: 1604; End: 2020 Strand: -

Full Sequence      

MAVAPWNQVRRVLQYAVTAMPAGKILMGIPNYGYDWIVGSSAAATVVSNVGAINIAAQNN
AQIFFDETAKAPYFNYRDSAGRRHEVWFEDARSIQAKLDLVREFGLAGVSFWHIGTYFAQ
AWEVLNANFLVNKVRSPR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	4	119	2.1e-23	0.38175675675675674

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	9.13e-58	1	125	187	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.28e-46	1	129	291	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	4.00e-18	20	116	224	333	Glyco_18 domain.
cd06549	GH18_trifunctional	6.08e-16	1	122	179	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02875	GH18_chitobiase	2.29e-15	1	114	201	336	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ77090.1	1.10e-49	1	134	290	425
AGK99433.1	1.10e-49	1	134	290	425
AOZ80887.1	1.10e-49	1	134	290	425
AJA53944.1	1.10e-49	1	134	290	425
QNU67347.1	2.53e-47	1	134	290	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.55e-36	1	133	294	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	4.52e-35	1	133	296	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	1.20e-25	3	114	195	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.72e-16	13	125	200	310	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	2.54e-14	3	115	205	330	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.35e-39	2	133	293	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q9K3E4	4.31e-35	1	133	293	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P0DPJ9	4.31e-35	1	133	293	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O05495	4.23e-27	3	134	287	420	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	1.25e-17	2	125	216	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995550	0.004337	0.000091	0.000010	0.000006	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002039_01353.