CAZyme Information: MGYG000002033_02650

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_02650
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		46054.77	6.5709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 51538; End: 52740 Strand: +

Full Sequence      

MKKAFSFICVGLMALSCTGERANDLVSQDFAFADKQLRYALTETDSVRNSLGKTPEELPS
PRNIQADGSLRLVRARDWCSGFFPGELWYMYEYTKDDFWKKKAEFQTELLEPLKSYKGTH
DLGFMLYCSYGNGYRMEQSDKYKQVLLEGANSLASRFNPVVGCIRSWDHNGDKWQYPVII
DNMMNLEYLFWATKVSGDSTFYKIAVTHADNTMKNHFRKDYSSYHVIDYDTITGDVRNKH
THQGYAHESAWARGQAWGLYGYTMCYRETGDKRYLNQAEAIASFIFNHPNLPSDLIPYWD
YNDPEIPASPRDVSAAAIAASALYELSTYSDKGTQYKKWADTILKNLTESYRVPLNQMHG
FLLRSSTGHKPAGTEIDVPIVYADYYFLEALIRKRNLEND

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	75	393	8.5e-131	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.40e-09	77	268	28	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50614.1	1.01e-291	1	398	1	398
BCG53902.1	2.23e-194	8	398	14	404
SCD21941.1	3.00e-188	8	399	12	405
QUT48710.1	1.56e-180	1	400	1	397
ALJ44845.1	3.41e-174	10	400	14	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.32e-119	60	393	55	387	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	5.96e-49	56	393	48	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.09e-49	56	393	49	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.66e-48	56	393	49	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	3.25e-48	56	393	49	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.99e-119	61	397	59	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	3.33e-48	56	393	49	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.22e-47	56	393	47	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	1.21e-45	66	393	28	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	2.03e-44	47	393	41	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000635	0.262754	0.735967	0.000217	0.000232	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_02650.