CAZyme Information: MGYG000002015_00249

Basic Information

• Species: Porphyromonas endodontalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas endodontalis
• CAZyme ID: MGYG000002015_00249
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42644.59	9.098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002015	1381551	MAG	Spain	Europe

• Gene Location: Start: 5183; End: 6328 Strand: -

Full Sequence      

MRYFLIAGEASGDLHGAHLIRAIKAEDPSATFAFMGGDQMAYEAGRRPIVHYSKVAFMGF
ISVLRHLPEIRFAAHLVQQEIKDFDPHVVIPIDYSGFNFRYILPFVDKALPRTSVFYYIP
PKVWAWKKKRTKKLRTLCTQVLSILPFEEEFLIRHKVNAYYVGNPCVDAVGKYWDTWGDP
QAKVALCNKTPQLTIEHPIVAILAGSRRAEIKQNLPLMLTTLRTYYPEYQCVIAGAPGIE
AEFYTPLIQGYKAEVLFGQTYGILAAADFALVTSGTATLETALIGTPQIVCYRSIGSPLV
NWAFSRLPISYFSLVNLILDTPLVEELLAAKATPEHLHSAIERLLSSTQQISEGYARLRS
QLGRVPAARTAAQVITRSIIH

Enzyme Prediction     

No EC number prediction in MGYG000002015_00249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	2.6e-95	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.78e-88	1	380	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.83e-85	1	375	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.49e-68	4	373	2	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.09e-56	5	359	10	359	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.85e-35	1	375	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH73726.1	4.81e-110	1	379	1	375
AEE12174.1	4.20e-105	1	381	1	368
ATS02318.1	3.96e-104	1	375	1	369
AIJ35071.1	3.96e-104	1	375	1	369
AUR47837.1	3.96e-104	1	375	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.39e-34	5	375	11	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.39e-34	5	375	11	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.44e-52	2	375	6	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q0A7J2	2.35e-51	1	375	1	374	Lipid-A-disaccharide synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=lpxB PE=3 SV=1
B6J9H1	3.99e-51	5	375	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
Q6ALW0	9.97e-51	5	374	14	381	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B6J161	1.54e-50	5	375	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002015_00249.