CAZyme Information: MGYG000002007_01225

Basic Information

• Species: Alistipes dispar
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes dispar
• CAZyme ID: MGYG000002007_01225
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		73308.73	4.8437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002007	2708946	MAG	Spain	Europe

• Gene Location: Start: 105484; End: 107472 Strand: +

Full Sequence      

MMQKLLWAAFVCCTTLACTPKTEVSSPDGSIRLKFAADRKSGEMRYTVSVGDRPLFGPSL
LGLEAAEADLAHDFRVDEAEYASVDEEWTQPWGENKCNRSRYNEMAVALHRGGEVRLTMR
FRLFDDGLGFRYEYEVPACDSLVVTGELTEFRFAADGDTWTVPADSGVCEPLCRAMPLRD
LGDADTPATFRVAGLYGSIHEAALYDYPEMTLRRCDSLAFRCDLAPLPDGTKARVAGRFV
TPWRTVHLASEAVGLINSSLILNLNEPSKIGDTEWIRPMKCIGVRWPTPSESDSRTAEER
YDAATEQVKRYLEFAADNRIDAVLIGRSEGRETRNSARRSDCCGPYRDFDIAAIAGYARD
LSIELIGCRGTDDCVSGCGRQLDSALMRYAGLGMHNLMTDFSGTLPDGCSRRSQYGVRHC
RRIVEAAARHCMTVDMREPVKDCGIRRTWPNMMTRSYGCGDARCAGGPPSHGVMLPFTRL
LAGPMGCASGTFDILSECARDSVRFGLRDCGEEAGMRVNSTLAGQIADWVILYSPLQMAS
DRIEHYEGHPAFRFFRDFDPDCDWSRALAGEPGEYVVVVRRAGDRFYFGAATNERPRTLH
FELDFLEPEVTYEAAIYADAPDADWRTDPTACDVSVRYVTSADAIDVVLAPGGGQAISFL
PL

Enzyme Prediction     

No EC number prediction in MGYG000002007_01225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	11	659	9.8e-161	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	1.88e-70	26	267	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.25e-64	272	558	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	7.47e-35	562	659	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL07206.1	0.0	1	662	1	662
AFL78734.1	6.17e-284	17	661	16	663
QUT71305.1	5.83e-239	1	660	1	667
BCA50408.1	1.17e-238	1	660	1	667
QCQ36404.1	1.66e-238	5	662	7	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQC_A	1.90e-116	24	662	3	661	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	2.67e-116	24	662	3	661	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	2.67e-116	24	662	3	661	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	3.18e-94	23	658	4	702	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	3.26e-94	23	658	13	711	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	1.12e-94	9	658	11	722	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	1.67e-30	2	657	1	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.90e-25	25	658	44	620	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.244803	0.754597	0.000094	0.000117	0.000103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002007_01225.