CAZyme Information: MGYG000001995_02116

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_02116
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37560.28	9.9534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 15766; End: 16734 Strand: +

Full Sequence      

MYSKIIIFVRFIIYSQKTAMRFTLRILFLTAVLAFALNTEAEGQRKIPSYEKYIKQYSDI
AIRHQKKYRIPASITLAQGIFESGAGQSVLARKSNNHFGIKCHSDWGGKRVYHDDDYKGE
CFRKYPKVEDSYEDHALFLVNRPRYAPLFKLNIKDYKGWAKGLQKCGYATDRAYANKLIK
VIEDYELYRYDSAKGIKSTRTKQKQTVPVSKYTVYRTFGLLYVYAKDNDNLDNIARSLDF
KVKDLKKFNEIPEDFPLQEGDIIYLEKKKKKADKPAYDHVVQVGESMHSISQKYGIQIKS
LYKMNKKDGDYVPEEGDVLKLR

Enzyme Prediction     

No EC number prediction in MGYG000001995_02116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	59	187	1.4e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	4.35e-41	51	191	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	5.67e-40	51	199	44	196	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	5.61e-28	49	191	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.76e-27	59	187	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK06347	PRK06347	5.65e-21	72	312	172	441	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK92151.1	2.10e-169	20	322	1	302
QUR47394.1	2.10e-169	20	322	1	302
QIX64041.1	2.10e-169	20	322	1	302
QUT94154.1	4.24e-169	20	322	1	302
AST54914.1	1.72e-168	20	322	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.25e-13	70	182	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.70e-13	70	182	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3FI7_A	6.53e-13	48	191	27	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3K3T_A	1.79e-12	70	182	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.55e-11	38	191	45	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.16e-17	32	191	27	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	8.70e-15	37	186	147	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	1.15e-14	72	312	202	464	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	7.71e-13	38	189	149	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	2.15e-10	41	195	230	395	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.188129	0.803326	0.007561	0.000360	0.000287	0.000320

TMHMM  Annotations     

start	end
21	38