CAZyme Information: MGYG000001995_00834

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_00834
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
968		107771.09	8.4287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 38025; End: 40931 Strand: -

Full Sequence      

MYRSVDKEKMNHWVDSVFDSMSNDERIGQLFMIILNPKDDNRNMQRLKRYIDEIKIGGIL
FHKGDPETQALVTNRAQQSSKVPLLISLDGEWGLSMRLSGTTRFPKNMMLGAIEDNNLIT
EYGREVARQCKEMGIHINFAPDIDVNSNTDNPVIGIRSFGESPAAVADKGIAYAKGLEEN
GILSVAKHFPGHGDTSEDSHNTLPAVYHDRARLDSVELYPFKRYIQEGFAGVMTGHLYVP
ALDKTNRPSSLSEPIVTGLLKKELQFSGLCFTDALAMKGATSNKSDNPSVKALLAGNDIL
LAPAAPFTDFAAVKEAIEDGILNLEDIEAKCLKILQYKYIAGLNHYKPVELKGLSGRLNS
PHAAWLAAKLNSEAITLLKNENDLLPLKQLGKKNTAVLSIGDAVGNSFQTMVNRYDTVAC
FSISRTATAAQVQQVYKKLEGYDRIICSVHTVRIPENPALRKLAEKKELILAFFTLPYFA
KEYKQTVEKAKAVIMGYEMTPLAQEYAAQMIFGGVAAKGKLPVSIPGLYFAGTGIFTEKT
RLGYHEPEEVGLNAVRLNEIDSIVQEGLDKQAYPGCQVLVAKNGMVIYDKSFGYFDYSGS
QPVDNDAVYDLASSSKATGTLLAVMKAYDRKKFSLNSKISEFVPELKSSDKKDLNIKELL
YHQSGLTPSINFYLDAMDKDSYTGSLYSRVKDAAHPVQFDGKTYVREDVAYLPGLVSNKK
KPGFTTEVARDFYLNTSFKDSIIKEIKDSKLRNRGKFKYSCINFILLKMMVEKQINQPMD
SLLDTDFFRPLGAWHTAYNPLHRMDTSRIVPTENDRFVRHQQLRGYVHDEAAAFQGGVSG
NAGLFSNANDLAKILQLYLNLGVYGDERYLSAETSRLFTQSKSPTSHRGLGFDKPLVGNP
RTSTCGTLAPPSVYGHTGYTGTCFWVDPDNQMIYIFLSNRVNPTRANNKLSSLDIRTRIQ
DTIYKALM

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	76	301	7.9e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.04e-75	21	399	1	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.05e-70	24	335	3	314	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	7.93e-63	545	967	28	431	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.18e-44	560	945	1	313	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	3.59e-40	547	949	28	372	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT21701.1	0.0	1	967	25	991
QIX64335.1	0.0	1	967	25	991
QJE31090.1	0.0	1	967	25	991
QUT50763.1	0.0	1	967	25	992
BBK92319.1	0.0	1	967	25	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	7.98e-63	15	544	36	632	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.31e-62	15	544	10	606	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.22e-62	15	544	40	636	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	3.45e-61	25	525	15	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	3.49e-52	47	338	50	346	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.37e-62	15	544	36	632	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P77619	4.23e-48	547	967	30	431	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
P48823	1.11e-47	47	388	55	426	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q8XBJ0	1.44e-47	547	967	30	431	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1
B5F0K5	3.63e-42	547	951	30	406	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella agona (strain SL483) OX=454166 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_00834.